DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and tfg3

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_593114.1 Gene:tfg3 / 2541729 PomBaseID:SPAC22H12.02 Length:241 Species:Schizosaccharomyces pombe


Alignment Length:199 Identity:54/199 - (27%)
Similarity:79/199 - (39%) Gaps:61/199 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QWK---VYLKPYFNEDMSIYVKKVHFKLHESYANPNRIVVKPPYEITETGWGEFEVIIKIYFND- 102
            :|.   |.|.|...|..:.:|.:|.:|||.::.||.|.:.|||::|.|.||||||:.|.||:.| 
pombe    34 EWSIKLVCLNPQGEETDASFVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYADK 98

  Fly   103 ------------QSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSESYEEIVFQEPTQIL 155
                        |.|.    ||         .|.||:.:.   |:.|                  
pombe    99 GGEHRFLHYLHFQQEH----YH---------EDIELNINA---TRPG------------------ 129

  Fly   156 QHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKVKGEIVTLKDKLKLARETISKFKAELA 220
                ||...:|.|.:...:|..|:..|.       |:|.:.|:...|.|.|.....:.|....|.
pombe   130 ----LLKALTATGEVPGYSDEGEEARKD-------KRKNESEVGAGKKKAKAKPVDMDKLAEGLQ 183

  Fly   221 KVQK 224
            |:|:
pombe   184 KLQE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 32/92 (35%)
tfg3NP_593114.1 TFG3 1..238 CDD:227366 54/199 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.