DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and Y105E8B.7

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_493542.2 Gene:Y105E8B.7 / 190914 WormBaseID:WBGene00013692 Length:269 Species:Caenorhabditis elegans


Alignment Length:217 Identity:61/217 - (28%)
Similarity:110/217 - (50%) Gaps:40/217 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVKPIVYGNIARSFGKKREEDGHTHQWKVYLKPYFNEDMSIY-----VKKVHFKLHESYANPNRI 76
            ||:.||..:..|.  .:..|:||||:|.:::|| .|.|...:     ::||.|::|||:|.|.|.
 Worm     3 IVEVIVGHSSTRL--PENNENGHTHKWTLFVKP-GNRDYDEFPDNKLIQKVKFEIHESFAQPVRF 64

  Fly    77 VVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSE 141
            |.|||::|||||:..|..::.|:.|..:|:|.|..:.|.||..       .....::|:|.:|.:
 Worm    65 VTKPPFKITETGFASFTTLVTIFLNLPNEKPRTIPYELTLFTG-------DQDVQLETQKLVVQK 122

  Fly   142 ----SYEEIVFQEPTQILQHYLLLSEQSANGLLTHDTDFEEKKTKTLDNIVNVKQKVKGEIVTLK 202
                :|.|::        :.|....::.|: |:::|   |:..::.:..|..||::...:     
 Worm   123 DVPPAYLELI--------KKYARTKKRKAS-LISND---EKSPSRKMHKITPVKEEESSQ----- 170

  Fly   203 DKLKLARE---TISKFKAELAK 221
             |:..::|   .|.|...|:.|
 Worm   171 -KMSKSKEKGVPIPKIDIEIEK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 34/83 (41%)
Y105E8B.7NP_493542.2 YEATS 24..105 CDD:281374 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S932
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23195
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.