DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and yeats2

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002660941.3 Gene:yeats2 / 100320774 ZFINID:ZDB-GENE-081104-292 Length:1421 Species:Danio rerio


Alignment Length:135 Identity:50/135 - (37%)
Similarity:74/135 - (54%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GDSGGRLKGVTIVKPIVYGNIARSFG--KKREEDGHTHQWKVYLKPYFNE-DMSIYVKKVHFKLH 67
            ||...||   .:.|.||.||:::...  |:.|.|..||:|.||::....| .:..:||||.|.||
Zfish   195 GDDASRL---YMKKTIVVGNVSKYIAPDKREENDQSTHKWMVYVRGSRKEPSIDHFVKKVWFFLH 256

  Fly    68 ESYANPNRI--VVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELSSST 130
            .|| .||.:  |.:||:.:|..|||||.|.::|:|.||..:.:...|.|||.::......|.:.|
Zfish   257 PSY-KPNDLVEVSEPPFHLTRRGWGEFPVRVQIHFKDQRNKRIDIIHHLKLDRTYTGLQTLGAET 320

  Fly   131 TMDTK 135
            .:|.:
Zfish   321 VVDVQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 35/81 (43%)
yeats2XP_002660941.3 SCAB_CC <16..>75 CDD:293317
YEATS 228..307 CDD:281374 34/79 (43%)
PHA03255 938..>1109 CDD:165513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.