DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gas41 and yeats2

DIOPT Version :9

Sequence 1:NP_609086.1 Gene:Gas41 / 33973 FlyBaseID:FBgn0031873 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_012825478.1 Gene:yeats2 / 100135359 XenbaseID:XB-GENE-5865259 Length:1238 Species:Xenopus tropicalis


Alignment Length:171 Identity:57/171 - (33%)
Similarity:83/171 - (48%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IVKPIVYGNIARSF--GKKREEDGHTHQWKVYLKPYFNE-DMSIYVKKVHFKLHESYANPNRI-- 76
            :.|.||.||:::..  .|:.|.|..||:|.||::....| .:..:||||.|.||.|| .||.:  
 Frog   196 VKKTIVVGNVSKYIPPDKREENDQSTHKWMVYVRGSRKEPSIDHFVKKVWFFLHPSY-KPNDLVE 259

  Fly    77 VVKPPYEITETGWGEFEVIIKIYFNDQSERPVTCYHILKLFQSPVVDGELSSSTTMDTKKGLVSE 141
            |.:||:.:|..|||||.|.::|:|.|...:.:...|.|||.:               |..||.:.
 Frog   260 VSEPPFHLTRRGWGEFPVRVQIHFKDSQNKRIDIIHNLKLDR---------------TYTGLQTL 309

  Fly   142 SYEEIVFQEPTQILQHYL---LLSEQSAN-------GLLTH 172
            ..|.:|   ..:|.:|.|   .|..||:|       .||:|
 Frog   310 GAETVV---EVEIYRHSLGEDFLGSQSSNECAQSEASLLSH 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gas41NP_609086.1 YEATS 40..119 CDD:281374 34/81 (42%)
yeats2XP_012825478.1 YEATS 221..300 CDD:281374 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482359at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.