DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and CNTN2

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_047285058.1 Gene:CNTN2 / 6900 HGNCID:2172 Length:1187 Species:Homo sapiens


Alignment Length:695 Identity:158/695 - (22%)
Similarity:257/695 - (36%) Gaps:176/695 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SPGVRILRAPESLVAPLGDEVVLEC---------------ETSLQPERFEW--SHRSSRSPGAGF 97
            :|.:: .|.|....|.:|.:|.|||               :.||.|   :|  :..:.:.|...|
Human   238 APSIK-ARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSP---QWTTAEPTLQIPSVSF 298

  Fly    98 KYLKTGTAKANVSQEAAISRLRVLVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESE 162
            :  ..||.:.    ||..|:.|..|:             |.::|.:....|::.|.:..|     
Human   299 E--DEGTYEC----EAENSKGRDTVQ-------------GRIIVQAQPEWLKVISDTEAD----- 339

  Fly   163 SPLQWRVSAGNSVLWSCGQQVQSNPSASWSYYRNG--------VEIKPEFIGTNGNLFLSNVSSE 219
                    .|:::.|.|....:..|:..|  .|||        ||:      ..|:|..|.:|.|
Human   340 --------IGSNLRWGCAAAGKPRPTVRW--LRNGEPLASQNRVEV------LAGDLRFSKLSLE 388

  Fly   220 SSGSYSCQATNP-----ASGERIQLPGSLQLQ-VTPEQRSESKSPHLLRGQPSSQEITIREGSSL 278
            .||.|.|.|.|.     ||.|       |.:| :.|:          .|..|..:.|....|..:
Human   389 DSGMYQCVAENKHGTIYASAE-------LAVQALAPD----------FRLNPVRRLIPAARGGEI 436

  Fly   279 LLLCPGVGSPPPTVVWSSPDVVGAVKNKRSKVFGHALEISNTRVNDAGTYICFQDNGVRPALEHY 343
            |:.|....:|...|:||....:....::.:......|.|.|...:|.|.|.||.:|.:..|....
Human   437 LIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTG 501

  Fly   344 IKVHVEQPPQIVRPPWADLTNEGDRLKLECKATGVPTPEI--YWLLN----------GH---SSI 393
            | :.|....:|...|.:...|.||.|.|:|.|:..||.::  .|.|:          ||   :::
Human   502 I-LSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNV 565

  Fly   394 DDSEAELSNNFLILHSVLKRHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRESGGTHRPKPNQ 458
            .::..:|:    ||::.| ||.|...|.|:..:...|....:.|..                   
Human   566 KETIGDLT----ILNAQL-RHGGKYTCMAQTVVDSASKEATVLVRG------------------- 606

  Fly   459 GSRQKQMYPPTPPN---VTRLSDESVMLRWMVPRNDGLPIVIFKVQYRM--VGKRKNWQTTNDNI 518
                    ||.||.   |..:.|.::.|.|....::..||..:.:|.|.  .||.|..:|...||
Human   607 --------PPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANI 663

  Fly   519 PYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPE 583
            .          |.:.||.|..|.|...|.||::|.......:.|..|:|...:..|   |...|.
Human   664 E----------GNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAA---PSVAPS 715

  Fly   584 LLEIEEYSETAVVLHWSLAS----DADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSF----- 639
            .|.....:...::::|:..|    :.|..   ||...:|...|. .:..|.:.||.|:.|     
Human   716 GLSGGGGAPGELIVNWTPMSREYQNGDGF---GYLLSFRRQGST-HWQTARVPGADAQYFVYSNE 776

  Fly   640 KIAPLETATMYEFKLQSFS--AASASEFSALKQGRTQRPKTSTTE 682
            .:.|.   |.:|.|::|::  .......:||.....:.|:.:.|:
Human   777 SVRPY---TPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTK 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 19/81 (23%)
Ig strand B 278..282 CDD:409353 1/3 (33%)
Ig strand C 291..295 CDD:409353 1/3 (33%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 25/99 (25%)
Ig strand B 369..373 CDD:409353 2/3 (67%)
Ig strand C 382..386 CDD:409353 0/5 (0%)
Ig strand E 404..407 CDD:409353 0/2 (0%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
FN3 467..565 CDD:238020 29/102 (28%)
FN3 582..>655 CDD:238020 18/81 (22%)
CNTN2XP_047285058.1 IgI_1_Contactin-2 35..131 CDD:409437
Ig strand A 38..42 CDD:409437
Ig strand A' 45..50 CDD:409437
Ig strand B 56..64 CDD:409437
Ig strand C 69..75 CDD:409437
Ig strand C' 77..80 CDD:409437
Ig strand D 87..91 CDD:409437
Ig strand E 93..99 CDD:409437
Ig strand F 106..115 CDD:409437
Ig strand G 118..131 CDD:409437
Ig2_Contactin-2-like 139..228 CDD:409392
Ig strand A 141..146 CDD:409392
Ig strand B 150..156 CDD:409392
Ig strand C 164..170 CDD:409392
Ig strand C' 175..177 CDD:409392
Ig strand D 182..187 CDD:409392
Ig strand E 190..194 CDD:409392
Ig strand F 204..212 CDD:409392
Ig strand G 216..228 CDD:409392
Ig 239..324 CDD:472250 23/107 (21%)
Ig strand B 257..261 CDD:409353 2/3 (67%)
Ig strand C 270..274 CDD:409353 0/3 (0%)
Ig strand E 289..293 CDD:409353 0/3 (0%)
Ig strand F 303..308 CDD:409353 1/8 (13%)
Ig strand G 316..319 CDD:409353 1/15 (7%)
Ig4_Contactin-2-like 328..412 CDD:143205 28/111 (25%)
Ig strand A 328..331 CDD:143205 0/2 (0%)
Ig strand A' 335..339 CDD:143205 0/3 (0%)
Ig strand B 343..351 CDD:143205 2/7 (29%)
Ig strand C 357..362 CDD:143205 1/6 (17%)
Ig strand C' 364..367 CDD:143205 1/2 (50%)
Ig strand D 372..376 CDD:143205 2/9 (22%)
Ig strand E 378..383 CDD:143205 2/4 (50%)
Ig strand F 392..399 CDD:143205 3/6 (50%)
Ig strand G 403..412 CDD:143205 4/15 (27%)
Ig5_Contactin 417..505 CDD:409358 22/98 (22%)
Ig strand A 417..422 CDD:409358 2/14 (14%)
Ig strand A' 425..430 CDD:409358 1/4 (25%)
Ig strand B 434..441 CDD:409358 1/6 (17%)
Ig strand C 449..453 CDD:409358 1/3 (33%)
Ig strand D 467..470 CDD:409358 0/2 (0%)
Ig strand E 471..476 CDD:409358 1/4 (25%)
Ig strand F 484..492 CDD:409358 4/7 (57%)
Ig strand G 498..505 CDD:409358 1/7 (14%)
Ig6_Contactin-2 507..603 CDD:409440 25/100 (25%)
Ig strand A 507..513 CDD:409440 1/5 (20%)
Ig strand A' 516..521 CDD:409440 0/4 (0%)
Ig strand B 524..532 CDD:409440 4/7 (57%)
Ig strand C 541..545 CDD:409440 0/3 (0%)
Ig strand D 566..569 CDD:409440 0/2 (0%)
Ig strand E 570..574 CDD:409440 1/7 (14%)
Ig strand F 583..590 CDD:409440 2/6 (33%)
Ig strand G 597..601 CDD:409440 1/3 (33%)
FN3 618..705 CDD:238020 26/96 (27%)
FN3 726..800 CDD:238020 17/80 (21%)
FN3 815..907 CDD:238020 1/4 (25%)
PHA03247 <989..1184 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.