DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and Cdon

DIOPT Version :9

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_059054.2 Gene:Cdon / 50938 RGDID:708433 Length:1256 Species:Rattus norvegicus


Alignment Length:1019 Identity:210/1019 - (20%)
Similarity:332/1019 - (32%) Gaps:387/1019 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PESLVAPLGDEVVLECETSLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISRLRVL-V 122
            |.|.|..||..|||.|.......|..|.|...|        |...|.:..:.:    ..|.:| :
  Rat    34 PLSAVQKLGRPVVLHCSAKPVTARISWLHNGKR--------LDRNTEQIKIHR----GTLTILSL 86

  Fly   123 RPDTLGEYRCVG-------WFGPLVVT-STIARLELASTSLVDAQESESPLQWRVSAGNSVLWSC 179
            .|...|.|:||.       ..||..|: :.:|..:.::..::.|:|.           |:....|
  Rat    87 NPSLSGCYQCVANNSVGAVVSGPATVSAAALADFDSSTMHVITAEEK-----------NTGFIGC 140

  Fly   180 GQQVQSNPSA--------SWSYYRNGVEIKPEFIGTNGNLFLSNVSSESSGSYSCQATNPASGER 236
             :..:|||.|        .|..|..|..|    |..:|||.:.||||:..|||.|.|.||.:.|.
  Rat   141 -RVPESNPKAEVRYKIRGKWLMYSTGNYI----ILPSGNLQILNVSSKDKGSYKCAAYNPVTSEL 200

  Fly   237 IQLPGSLQLQVTPEQRSESKSPHLLR----------------------GQPSSQEITIREGSSLL 279
            ...|...:|.|:   |..|...|:|.                      |.|:||...:::|...|
  Rat   201 KVEPAGRKLLVS---RPSSDGFHILHPALSQALAVLPHSPVTLECVVSGVPASQVYWLKDGQDAL 262

  Fly   280 ----------------------------------------------------------------- 279
                                                                             
  Rat   263 SGSNWRRLYSHLATASIDPADSGNYSCVVGNNRSGDVKHVTYTVNVLEHASISKGLHDQKVSLGA 327

  Fly   280 ---LLCPGVGSPPPTVVW---SSPDVVGAVKNKRSKVFGHALEISNTRVNDAGTYICFQDNGVRP 338
               ..|...|:|.|...|   :.|    ...:.|....|..|:|:...:.|:|.|.|..|||: .
  Rat   328 TVRFTCEVHGNPAPNRTWFHNAQP----IRPSSRHLTEGSVLKITGVIMEDSGLYQCMADNGI-G 387

  Fly   339 ALEHYIKVHVEQP----PQIVRPPWADLTNEGDRLKLECKATGVPTPEIYW-----LLNGH-SSI 393
            .::...::.:||.    |.||..|......:||.:.|.|.|||.|.|.|:|     |:..| |.:
  Rat   388 FMQSTGRLQIEQDSGQRPVIVTAPANVEVTDGDFVTLSCNATGEPVPVIHWYGRHGLITSHPSQV 452

  Fly   394 DDSEAELSNNF---------------------LILHSVLKRHAGYVQCFARNRLGEHSAGTLLQV 437
            ..|::..|:.|                     |.:.:|...|||...|.|.|:.|...:...|.|
  Rat   453 LRSKSRKSHLFRPGDLDPEPVYLIMSQAGSSSLSIQAVTWEHAGKYTCEAVNKHGSTQSEAFLTV 517

  Fly   438 NPKQI-----------------QEPRE---------------SGG-------------------- 450
            .|.:.                 ::||:               |||                    
  Rat   518 VPFETNTKAEPVTPSEASQNDERDPRDGSESGLLNLFPVKVHSGGVELPAEKNASVPDAPNILSP 582

  Fly   451 --THRP-------------------------KPNQG----------------------------- 459
              ||.|                         |.:.|                             
  Rat   583 PQTHMPDTYTLVWRAGRDGGMPINAYFVKYRKLDDGSGAVGSWHTVRVPGSESELHLTELEPSSL 647

  Fly   460 -----------------------SRQKQ--------MYPPT------------------------ 469
                                   |::|.        .:||.                        
  Rat   648 YEVLMVARSAVGEGQPAMLTFRTSKEKMASSKNTQASFPPVGIPKRPVTSEASNSNFGVVLTDSS 712

  Fly   470 ----------PPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPK 524
                      .|.::..|:.||.:.|:...|.|.||..|||:|:.: |..:|....::||..|  
  Rat   713 RHSGVPEAPDRPTISMASETSVYVTWIPRANGGSPITAFKVEYKRM-KSSDWLVAAEDIPPSK-- 774

  Fly   525 WNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQ--PGAALD-PMPVPELLE 586
                    .:..|..|:|...|:||::|:....::..|:.|..:.:.  |....: |:..|.:..
  Rat   775 --------LSVEVRSLEPGSIYKFRVIAINHYGESFRSSASRPYQVAGFPNRFSNRPITGPHIAY 831

  Fly   587 IEEYSETAVVLHWS-LASDADEHLITGYYAYYRP--SSSAGEYFKATIEGA---HARSFKIAPLE 645
            .|..|:|.::|.|: :.|..:...|.|:|.||||  |.:..:|.:..:||:   |.    |..|:
  Rat   832 TEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHT----IGHLQ 892

  Fly   646 TATMYEFKLQSFSAASASEFSALK---------QGRTQRPKTSTTEEPTLQMGDRDTTTP--SHN 699
            ..|.|:.|:|.|:....||||.:.         .|.::.|....:..|: ..|:.....|  |..
  Rat   893 PETSYDIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPMKELSTPPS-SSGNGGNVGPATSPA 956

  Fly   700 ETFNMSPMLTGTIGGGAVLILLL-ISTCFCVCRRRNSRSRGNNP 742
            .:.:|..::.|.:.|..|||||: |:.|....|::::..:.:.|
  Rat   957 RSSDMLYLIVGCVLGVMVLILLVFIALCLWKSRQQSAIQKYDPP 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 IG_like 59..145 CDD:214653 25/94 (27%)
ig 265..330 CDD:278476 18/135 (13%)
IG_like 267..348 CDD:214653 21/151 (14%)
Ig 314..>377 CDD:299845 20/66 (30%)
IG_like 364..437 CDD:214653 27/99 (27%)
IGc2 365..427 CDD:197706 25/88 (28%)
FN3 467..565 CDD:238020 28/131 (21%)
fn3 580..655 CDD:278470 24/80 (30%)
CdonNP_059054.2 Ig 28..113 CDD:416386 24/90 (27%)
Ig strand A 28..31 CDD:409353
Ig strand B 45..52 CDD:409353 4/6 (67%)
Ig strand C 57..62 CDD:409353 2/4 (50%)
Ig strand C' 65..67 CDD:409353 1/9 (11%)
Ig strand D 73..77 CDD:409353 0/3 (0%)
Ig strand E 79..83 CDD:409353 1/3 (33%)
Ig strand F 92..100 CDD:409353 4/7 (57%)
Ig strand G 103..113 CDD:409353 2/9 (22%)
Ig 120..196 CDD:416386 26/91 (29%)
Ig strand A 120..123 CDD:409353 0/2 (0%)
Ig strand B 133..144 CDD:409353 2/22 (9%)
Ig strand C 149..155 CDD:409353 1/5 (20%)
Ig strand C' 157..160 CDD:409353 0/2 (0%)
Ig strand D 167..171 CDD:409353 2/7 (29%)
Ig strand E 173..179 CDD:409353 3/5 (60%)
Ig strand F 185..194 CDD:409353 5/8 (63%)
IGc2 236..294 CDD:197706 6/57 (11%)
Ig strand B 238..242 CDD:409353 0/3 (0%)
Ig strand C 251..255 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 0/4 (0%)
Ig strand G 300..303 CDD:409353 0/2 (0%)
Ig 320..397 CDD:416386 17/81 (21%)
Ig strand A' 320..324 CDD:409353 0/3 (0%)
Ig strand B 327..337 CDD:409353 1/9 (11%)
Ig strand C 342..348 CDD:409353 1/5 (20%)
Ig strand C' 349..352 CDD:409353 1/6 (17%)
Ig strand E 363..369 CDD:409353 2/5 (40%)
Ig strand F 376..384 CDD:409353 3/7 (43%)
Ig strand G 387..397 CDD:409353 0/9 (0%)
I-set 405..517 CDD:400151 31/111 (28%)
Ig strand A' 413..417 CDD:409353 0/3 (0%)
Ig strand B 421..429 CDD:409353 2/7 (29%)
Ig strand C 435..457 CDD:409353 6/21 (29%)
Ig strand C' 460..463 CDD:409353 1/2 (50%)
Ig strand D 471..479 CDD:409353 0/7 (0%)
Ig strand E 482..488 CDD:409353 1/5 (20%)
Ig strand F 496..504 CDD:409353 3/7 (43%)
Ig strand G 507..517 CDD:409353 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..550 2/27 (7%)
fn3 588..663 CDD:394996 3/74 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..696 4/24 (17%)
FN3 718..808 CDD:238020 26/100 (26%)
FN3 833..920 CDD:238020 29/90 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 929..952 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1174..1212
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1231..1256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102649at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.