DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and NCAM1

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:769 Identity:161/769 - (20%)
Similarity:277/769 - (36%) Gaps:200/769 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 GDEVVLECE-TSLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISRLRVLVRPDTLGEY 130
            |::.|:.|: .|..|....|.|:...      ..||.......:|..  ..::|.:.:.|. |.|
Human   132 GEDAVIVCDVVSSLPPTIIWKHKGRD------VILKKDVRFIVLSNN--YLQIRGIKKTDE-GTY 187

  Fly   131 RCVGW--------FGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNSVLWSCGQQVQSNP 187
            ||.|.        |..:.|...:.....|..::|:|         ..:.|.||...|..:....|
Human   188 RCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNA---------TANLGQSVTLVCDAEGFPEP 243

  Fly   188 SASWSYYRNGVEIKPE-------FIGTNGNLFLSNVSSESSGSYSCQATNPASGERIQLPGSLQL 245
            :.||:  ::|.:|:.|       |...:..|.:..|.......|.|.|.|.| ||:   ..::.|
Human   244 TMSWT--KDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKA-GEQ---DATIHL 302

  Fly   246 QVTPEQRSESKSPHLLRGQPSSQEITIREGSSLL-------LLCPGVGSPPPTVVW--SSPDVVG 301
            :|.                 :..:||..|..:.:       |.|...|.|.|::.|  |:.::..
Human   303 KVF-----------------AKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS 350

  Fly   302 AVK------NKRSKVFGHALEISNTRVN----------DAGTYICFQDNGV-RPALEHYIKVHVE 349
            ..|      .|:..:.||.:..|:.||:          |||.|||...|.: :.:...|::  |:
Human   351 EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLE--VQ 413

  Fly   350 QPPQIVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGH--SSIDDSEAELSN----NFLILH 408
            ..|:: :.|.|..|.||:::.:.|:....|:..|.|..:|.  .|.:.|..::.|    ::|.:.
Human   414 YAPKL-QGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVT 477

  Fly   409 SVLKRHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRESGGTHRPKPNQGSRQKQMYPPTPPNV 473
            ...:...|...|.|.||:|:.|...:|    .|...| .|....:.:|...:.|.|...|     
Human   478 PDSENDFGNYNCTAVNRIGQESLEFIL----VQADTP-SSPSIDQVEPYSSTAQVQFDEP----- 532

  Fly   474 TRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVT 538
                          ....|:||:.:|.::|.||: :.|.:          ||......|....||
Human   533 --------------EATGGVPILKYKAEWRAVGE-EVWHS----------KWYDAKEASMEGIVT 572

  Fly   539 --DLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIE-EYSETAVVLHWS 600
              .|||:.||..| ||..:.....|.:.:::|..|      |:..|...::| :..|....:..:
Human   573 IVGLKPETTYAVR-LAALNGKGLGEISAASEFKTQ------PVREPSAPKLEGQMGEDGNSIKVN 630

  Fly   601 LASDAD-----EHLITGYYAYYR--------PSSSAGEYFKATIEGAHARSFKIAPLETATMYEF 652
            |....|     .|.:..|.|...        ||.|.....|:....|....:.:|..:       
Human   631 LIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQ------- 688

  Fly   653 KLQSFSAASASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTTTPSHNETFNMSPMLTGTIGGGAV 717
              |..|.|:...|             .|:.:||....:...|          |.:.||.|.|..:
Human   689 --QGKSKAAHFVF-------------RTSAQPTAIPANGSPT----------SGLSTGAIVGILI 728

  Fly   718 LILLLI-----STCF---------CV----CRRRNSRSRGNNPNKPRMAELRDD 753
            :|.:|:     .||:         |:    |.:....::|.:..:.:.|..:|:
Human   729 VIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKDE 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 25/107 (23%)
Ig strand B 278..282 CDD:409353 1/10 (10%)
Ig strand C 291..295 CDD:409353 1/5 (20%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 3/4 (75%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 23/90 (26%)
Ig strand B 369..373 CDD:409353 0/3 (0%)
Ig strand C 382..386 CDD:409353 1/3 (33%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
FN3 467..565 CDD:238020 23/99 (23%)
FN3 582..>655 CDD:238020 14/86 (16%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653 15/66 (23%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 0/5 (0%)
Ig 211..307 CDD:472250 25/127 (20%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 244..248 CDD:409353 1/3 (33%)
Ig strand E 270..274 CDD:409353 1/3 (33%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 0/2 (0%)
IgI_NCAM-1 306..412 CDD:143277 25/107 (23%)
Ig strand A 306..311 CDD:143277 0/4 (0%)
Ig strand A' 315..319 CDD:143277 0/3 (0%)
Ig strand B 324..332 CDD:143277 2/7 (29%)
Ig strand C 338..344 CDD:143277 1/5 (20%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 1/5 (20%)
Ig strand E 377..383 CDD:143277 1/5 (20%)
Ig strand F 391..399 CDD:143277 4/7 (57%)
Ig strand G 402..412 CDD:143277 1/11 (9%)
IG_like 421..499 CDD:214653 20/77 (26%)
Ig strand B 432..436 CDD:409353 0/3 (0%)
Ig strand C 445..449 CDD:409353 1/3 (33%)
Ig strand E 472..476 CDD:409353 1/3 (33%)
Ig strand F 486..491 CDD:409353 1/4 (25%)
fn3 511..598 CDD:394996 27/117 (23%)
fn3 612..693 CDD:394996 14/89 (16%)
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.