DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and plum

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_651482.3 Gene:plum / 43197 FlyBaseID:FBgn0039431 Length:1298 Species:Drosophila melanogaster


Alignment Length:351 Identity:100/351 - (28%)
Similarity:144/351 - (41%) Gaps:46/351 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LRVLVRPDTLGEYRC-VGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSA--GNSVLWSC 179
            ||:.......|||.| :.|....|::..|.........|...|:..:    .:||  ...::.||
  Fly   123 LRLPTNEKASGEYYCKIEWDESAVISDRITVEYPVLKRLFPGQQQAA----NISALENKPLVLSC 183

  Fly   180 GQQVQSNPSASWSYYRNGVEIKPE---FIGTNGNLFLSNVSSESSGSYSCQATNP-ASGERIQLP 240
              ...|.|:|.:|:|.....:..:   .|.|||.|.|.::..|.:|.|.|.|.|. ||....|. 
  Fly   184 --PFLSVPAARFSWYFGNDSLTNDNSALILTNGTLILRHLRLEQAGKYKCVAQNTFASKTHRQF- 245

  Fly   241 GSLQLQVTPEQ-----RSES-------KSPHLLRGQPSSQEIT--IREGSSLLLLCPGVGSPPPT 291
             ..||||.|:.     ::|:       ....||   |:.|..|  :..|.|:||.|..|....|.
  Fly   246 -IWQLQVEPKDATFYPKNEAGITETAVSEAQLL---PAFQNATVFVPAGGSVLLQCHAVADFVPI 306

  Fly   292 VVWSSPDVVGAVKNKRSKVFGHALEISNTRVNDA---GTYICFQDNGVRPALEHYIKVHVEQPPQ 353
            |.:..|.     .||..::..:::..|.|..:.|   |.|.|     :.|......:|.|..||:
  Fly   307 VWYLQPP-----NNKMVRLSNNSVAYSITNASIARHEGRYSC-----ITPLETQNFQVIVTTPPR 361

  Fly   354 IVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLKRHAGYV 418
            ||.....::...|....|.|:|.|.|.|.|.|..||..........:|.|.|.:||...:..|..
  Fly   362 IVSRLPVEVVYIGLSRTLTCRAEGHPEPSITWYHNGVHLNSSYTRYISGNELHVHSFDSKEEGIY 426

  Fly   419 QCFARNRLGEHSAGTLLQVNPKQIQE 444
            ||.|||..||.||...|:.| :|::|
  Fly   427 QCVARNVAGEDSATGELRFN-RQLEE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 21/86 (24%)
Ig strand B 278..282 CDD:409353 2/3 (67%)
Ig strand C 291..295 CDD:409353 1/3 (33%)
Ig strand E 313..317 CDD:409353 0/3 (0%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 30/84 (36%)
Ig strand B 369..373 CDD:409353 1/3 (33%)
Ig strand C 382..386 CDD:409353 1/3 (33%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 2/2 (100%)
FN3 467..565 CDD:238020
FN3 582..>655 CDD:238020
plumNP_651482.3 Ig 179..245 CDD:409353 21/67 (31%)
Ig strand B 179..183 CDD:409353 0/3 (0%)
Ig strand C 192..196 CDD:409353 1/3 (33%)
Ig strand E 214..218 CDD:409353 2/3 (67%)
Ig strand F 228..233 CDD:409353 2/4 (50%)
Ig strand G 242..245 CDD:409353 0/2 (0%)
IG_like 284..356 CDD:214653 20/81 (25%)
Ig 360..443 CDD:472250 29/82 (35%)
Ig strand B 377..381 CDD:409353 1/3 (33%)
Ig strand C 390..394 CDD:409353 1/3 (33%)
Ig strand E 411..415 CDD:409353 2/3 (67%)
Ig strand F 425..430 CDD:409353 2/4 (50%)
Ig strand G 438..441 CDD:409353 2/2 (100%)
FN3 804..886 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.