DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and L1CAM

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_000416.1 Gene:L1CAM / 3897 HGNCID:6470 Length:1257 Species:Homo sapiens


Alignment Length:762 Identity:179/762 - (23%)
Similarity:272/762 - (35%) Gaps:172/762 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PGVRILRAPESLVAPLGDEVVLECETSLQPE-RFEWSHRS-------------SRSPGAGFKYLK 101
            |.|...::|..||....|::.|:||.|.:|| :|.|:...             .:||.:| .:..
Human    34 PPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSG-SFTI 97

  Fly   102 TGTAKANVSQEAAISRLRVLVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESESPL- 165
            ||. .:|.:|...             |.|||                 .||..|..|...|..| 
Human    98 TGN-NSNFAQRFQ-------------GIYRC-----------------FASNKLGTAMSHEIRLM 131

  Fly   166 -----QW--------RVSAGNSVLWSCGQQVQSNPSASWSYYRNG--VEIKPE---FIGTNGNLF 212
                 :|        .|..|.||:..|.....:.|..  .|:.|.  :.||.:   .:|.||||:
Human   132 AEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLR--IYWMNSKILHIKQDERVTMGQNGNLY 194

  Fly   213 LSNV-SSESSGSYSCQATNPASGERIQLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGS 276
            .:|| :|::...|.|.|..|.:...|| ...:.|:|........:.|.||....||..:...:|.
Human   195 FANVLTSDNHSDYICHAHFPGTRTIIQ-KEPIDLRVKATNSMIDRKPRLLFPTNSSSHLVALQGQ 258

  Fly   277 SLLLLCPGVGSPPPTVVWSSPDVVGAVKNKRSKVFGH--ALEISNTRVNDAGTYICFQDNGVRPA 339
            .|:|.|...|.|.||:.|..|.  |.:...|.....|  .|::......|.|.|.|..:|.:..|
Human   259 PLVLECIAEGFPTPTIKWLRPS--GPMPADRVTYQNHNKTLQLLKVGEEDDGEYRCLAENSLGSA 321

  Fly   340 LEHYIKVHVEQPPQIVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNG---HSSIDDSEAELS 401
             .|...|.||..|..:..|.:.|...|:..:|:|:..|.|.||:.|.:||   .....|.:..:.
Human   322 -RHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRPQPEVTWRINGIPVEELAKDQKYRIQ 385

  Fly   402 NNFLILHSVLKRHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRE--SGGTHRPKPNQGSRQ-- 462
            ...|||.:|........||.||||.|...|...:.|    :|.|.:  :.........|||..  
Human   386 RGALILSNVQPSDTMVTQCEARNRHGLLLANAYIYV----VQLPAKILTADNQTYMAVQGSTAYL 446

  Fly   463 --KQMYPPTP-------PNVTRLSDESVMLRWMVPRNDGLPIVIFKVQ-----YRMVGKRKNWQT 513
              |....|.|       ...|.|.||    |:....|..|.|...:..     :.:....:|..|
Human   447 LCKAFGAPVPSVQWLDEDGTTVLQDE----RFFPYANGTLGIRDLQANDTGRYFCLAANDQNNVT 507

  Fly   514 TNDN--------IPYGKPKWNSELGK--SFTASVT---DLKPQHTYRFRILAVYSNNDNKESNTS 565
            ...|        |..|......:.|.  :||...:   .|:|..|:|      ....|.:|...|
Human   508 IMANLKVKDATQITQGPRSTIEKKGSRVTFTCQASFDPSLQPSITWR------GDGRDLQELGDS 566

  Fly   566 AKFYLQPGA----ALD-----------------------------PMPVPELL--EIEEYSETAV 595
            .|::::.|.    :||                             |.|||.|:  ::...:::.|
Human   567 DKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPGPVPRLVLSDLHLLTQSQV 631

  Fly   596 VLHWSLASDADEHLITGYYAYYRPSSSAGE--YFKATIEGAH-ARSFKIAPLETATMYEFKLQSF 657
            .:.||.|.|.:.. |..|...:.....|.|  |....:.|.. :.:.|::|.   ..|.|::.:.
Human   632 RVSWSPAEDHNAP-IEKYDIEFEDKEMAPEKWYSLGKVPGNQTSTTLKLSPY---VHYTFRVTAI 692

  Fly   658 SAASASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTTTPSHNETFNM 704
            :.....|.|.:.: ....|:.:..:.|....|:       .|||.||
Human   693 NKYGPGEPSPVSE-TVVTPEAAPEKNPVDVKGE-------GNETTNM 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 24/83 (29%)
Ig strand B 278..282 CDD:409353 2/3 (67%)
Ig strand C 291..295 CDD:409353 1/3 (33%)
Ig strand E 313..317 CDD:409353 2/5 (40%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 1/2 (50%)
Ig 352..437 CDD:472250 26/87 (30%)
Ig strand B 369..373 CDD:409353 1/3 (33%)
Ig strand C 382..386 CDD:409353 1/3 (33%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
FN3 467..565 CDD:238020 24/122 (20%)
FN3 582..>655 CDD:238020 17/77 (22%)
L1CAMNP_000416.1 Ig 35..130 CDD:472250 29/126 (23%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 93..97 CDD:409353 1/4 (25%)
Ig strand F 111..116 CDD:409353 3/21 (14%)
Ig strand G 125..128 CDD:409353 0/2 (0%)
IgI_2_L1-CAM_like 140..230 CDD:409432 25/92 (27%)
Ig strand A 140..143 CDD:409432 0/2 (0%)
Ig strand A' 145..149 CDD:409432 0/3 (0%)
Ig strand B 152..160 CDD:409432 3/7 (43%)
Ig strand C 167..173 CDD:409432 1/7 (14%)
Ig strand C' 176..179 CDD:409432 0/2 (0%)
Ig strand D 185..189 CDD:409432 0/3 (0%)
Ig strand E 191..195 CDD:409432 3/3 (100%)
Ig strand F 206..214 CDD:409432 3/7 (43%)
Ig strand G 217..230 CDD:409432 3/13 (23%)
Ig3_L1-CAM 248..330 CDD:409460 24/84 (29%)
Ig strand B 260..264 CDD:409460 2/3 (67%)
Ig strand C 273..277 CDD:409460 1/3 (33%)
Ig strand E 295..299 CDD:409460 1/3 (33%)
Ig strand F 309..314 CDD:409460 2/4 (50%)
Ig strand G 322..325 CDD:409460 1/2 (50%)
Ig4_L1-CAM_like 334..422 CDD:409453 26/91 (29%)
Ig strand B 350..354 CDD:409453 1/3 (33%)
Ig strand C 363..367 CDD:409453 1/3 (33%)
Ig strand E 387..391 CDD:409453 1/3 (33%)
Ig strand F 401..406 CDD:409453 2/4 (50%)
Ig strand G 414..417 CDD:409453 1/2 (50%)
Ig 428..514 CDD:472250 17/89 (19%)
Ig strand B 444..448 CDD:409353 0/3 (0%)
Ig strand C 457..461 CDD:409353 0/3 (0%)
Ig strand E 480..484 CDD:409353 1/3 (33%)
Ig strand F 494..499 CDD:409353 0/4 (0%)
Ig strand G 507..510 CDD:409353 1/2 (50%)
Ig_3 519..594 CDD:464046 16/80 (20%)
Cell attachment site. /evidence=ECO:0000255 554..556 1/7 (14%)
FN3 612..709 CDD:238020 22/101 (22%)
FN3 <627..>837 CDD:442628 25/117 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 698..725 5/34 (15%)
fn3 824..907 CDD:394996
FN3 918..1003 CDD:238020
Bravo_FIGEY 1144..1233 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1176..1207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1226..1257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.