DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and Igsf10

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_038958192.1 Gene:Igsf10 / 310448 RGDID:735030 Length:2647 Species:Rattus norvegicus


Alignment Length:654 Identity:137/654 - (20%)
Similarity:231/654 - (35%) Gaps:201/654 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AHPAHPSPGVRIL-RAPESLVAPLGDEVVLECETSLQPE-RFEWSHRSSRSPGAGFKYLKTGTAK 106
            ::||      ||| |..:.:....|..|.|:|.....|. ...|.                 .|.
  Rat  1766 SYPA------RILDRHVKEITVHSGSTVELKCRVEGMPRPTVSWI-----------------LAN 1807

  Fly   107 ANVSQEAAISRLRVLVRPD-TL----------GEYRCVGWFGPLVVTSTIARLELASTSLVDAQE 160
            ..|..|.|....:|.|.|| ||          |.|:||. ..|....|.:.::::.:...|..::
  Rat  1808 QTVVSETAKGSRKVWVTPDGTLIIYNLSLYDRGFYKCVA-SNPSGQDSLLVKIQVITAPPVIIEQ 1871

  Fly   161 SESPLQWRVSAGNSVLWSCGQQVQSNPSASWSYYRNGVEIKP-------EFIGTNGNLFLSNVSS 218
            ....:...:  |.|:...|..:....||..|..| :|.|:||       .|:..||.|::.:::.
  Rat  1872 KRQAIVGVL--GGSLKLPCTAKGTPQPSVHWVLY-DGTELKPLQLTHSRFFLYPNGTLYIRSIAP 1933

  Fly   219 ESSGSYSCQATNPASGERIQLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEIT-IREGSSLLLLC 282
            ...|:|.|.||:.:..||       ::.:...:..|:    :.|.:.:||:.| :..|..|||.|
  Rat  1934 SVRGTYECIATSSSGSER-------RVVILTVEEGET----IPRIETASQKWTEVNLGEKLLLNC 1987

  Fly   283 PGVGSPPPTVVWSSPD--VVGAVKNKRSKVFGH---ALEISNTRVNDAGTYICFQDNGVRPALEH 342
            ...|.|.|.::|..|.  |:.......|::..:   :|.:.:....|||.|:|...|.:...|  
  Rat  1988 SATGDPKPRIIWRLPSKAVIDQWHRMGSRIHVYPNGSLVVGSVTEKDAGDYLCVARNKMGDDL-- 2050

  Fly   343 YIKVHVE---QPPQIVRPPW-ADLTNEGDRLKLECKATGVPTPEIYW------LLNGHSSIDDSE 397
             :.:||.   .|.:|.:..: ......|...:::|||:|.|.||:.|      :||..:..|||.
  Rat  2051 -VLMHVRLRLTPAKIEQKQYFKKQVLHGKDFQVDCKASGSPVPEVSWSLPDGTVLNNVAQADDSG 2114

  Fly   398 AE------LSNNFLILHSVLKRHAGYVQCFARNRLGEHSAG---TLLQVNPKQIQEPR-----ES 448
            ..      ..|..|..::|.....|...|.|:|.||:....   |:|...|:..|..:     .:
  Rat  2115 YRTKRYTLFHNGTLYFNNVGMAEEGDYICSAQNTLGKDEMKVHLTVLTAIPRIRQSYKTTMRLRA 2179

  Fly   449 GG--------THRPKPNQGSRQKQMYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMV 505
            |.        |..||||                         :.|::|.|:   ::.|       
  Rat  2180 GDTAVLDCEVTGEPKPN-------------------------VFWLLPSNN---VISF------- 2209

  Fly   506 GKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKP-----------------QHTYRFRILA- 552
                    :||...:...:         |.|:..:||                 ..||:..|:: 
  Rat  2210 --------SNDRFTFHANR---------TLSIHKVKPLDSGDYVCVAQNPSGDDTKTYKLDIVSK 2257

  Fly   553 ------VYSNNDNKESNT---SAKFY--------------LQPGAALDPMPVPELLEIEEYSETA 594
                  :|:|....::..   |.|::              :.||....|.|         |..:.
  Rat  2258 PPLINGLYANKTVIKATAIRHSKKYFDCRADGIPSSQVTWIMPGNIFLPAP---------YFGSR 2313

  Fly   595 VVLH 598
            |.:|
  Rat  2314 VTVH 2317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 23/87 (26%)
Ig strand B 278..282 CDD:409353 3/3 (100%)
Ig strand C 291..295 CDD:409353 0/3 (0%)
Ig strand E 313..317 CDD:409353 1/6 (17%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 26/100 (26%)
Ig strand B 369..373 CDD:409353 0/3 (0%)
Ig strand C 382..386 CDD:409353 2/9 (22%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 0/5 (0%)
FN3 467..565 CDD:238020 15/124 (12%)
FN3 582..>655 CDD:238020 3/17 (18%)
Igsf10XP_038958192.1 LRRNT 78..110 CDD:214470
leucine-rich repeat 89..108 CDD:275380
LRR <98..>282 CDD:443914
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..156 CDD:275380
leucine-rich repeat 157..180 CDD:275380
leucine-rich repeat 181..204 CDD:275380
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..260 CDD:275380
Ig 532..605 CDD:472250
Ig strand B 543..547 CDD:409353
Ig strand C 556..561 CDD:409353
Ig strand E 584..588 CDD:409353
Ig strand F 598..603 CDD:409353
IG_like 632..712 CDD:214653
Ig strand B 641..645 CDD:409570
Ig strand C 654..658 CDD:409570
Ig strand E 678..682 CDD:409570
Ig strand F 692..697 CDD:409570
Ig strand G 705..708 CDD:409570
DUF5585 <1022..1351 CDD:465521
Herpes_BLLF1 <1189..1500 CDD:282904
Ig 1690..1763 CDD:472250
Ig strand B 1690..1694 CDD:409353
Ig strand C 1703..1707 CDD:409353
Ig strand E 1730..1734 CDD:409353
Ig strand F 1744..1749 CDD:409353
Ig strand G 1758..1761 CDD:409353
Ig 1768..1861 CDD:472250 28/116 (24%)
Ig strand B 1787..1791 CDD:409353 2/3 (67%)
Ig strand C 1800..1804 CDD:409353 0/3 (0%)
Ig strand E 1827..1831 CDD:409353 2/3 (67%)
Ig strand F 1841..1846 CDD:409353 2/4 (50%)
Ig strand G 1854..1857 CDD:409353 1/2 (50%)
Ig 1866..1958 CDD:472250 23/101 (23%)
Ig strand B 1884..1888 CDD:409570 0/3 (0%)
Ig strand C 1897..1902 CDD:409570 2/4 (50%)
Ig strand E 1924..1928 CDD:409570 2/3 (67%)
Ig strand F 1938..1943 CDD:409570 2/4 (50%)
Ig strand G 1951..1954 CDD:409570 1/9 (11%)
Ig_3 1965..2044 CDD:464046 22/78 (28%)
IG_like 2077..2160 CDD:214653 23/82 (28%)
Ig strand B 2080..2084 CDD:409353 0/3 (0%)
Ig strand C 2093..2097 CDD:409353 1/3 (33%)
Ig strand E 2126..2130 CDD:409353 1/3 (33%)
Ig strand F 2140..2145 CDD:409353 1/4 (25%)
Ig strand G 2153..2156 CDD:409353 0/2 (0%)
IG_like 2178..2252 CDD:214653 18/125 (14%)
Ig strand B 2183..2187 CDD:409353 0/3 (0%)
Ig strand C 2196..2200 CDD:409353 1/28 (4%)
Ig strand E 2220..2224 CDD:409353 1/12 (8%)
Ig strand F 2234..2239 CDD:409353 0/4 (0%)
Ig strand G 2247..2250 CDD:409353 0/2 (0%)
IG_like 2283..2354 CDD:214653 7/44 (16%)
Ig strand C 2294..2298 CDD:409353 0/3 (0%)
Ig strand E 2320..2324 CDD:409353
Ig strand F 2334..2339 CDD:409353
Ig_3 2360..2439 CDD:464046
Ig_3 2455..2534 CDD:464046
Ig_3 2551..2633 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.