DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and cntn2

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_571521.1 Gene:cntn2 / 30726 ZFINID:ZDB-GENE-990630-12 Length:1040 Species:Danio rerio


Alignment Length:728 Identity:175/728 - (24%)
Similarity:279/728 - (38%) Gaps:152/728 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PESLVAPLG---DEVVLECETSLQPERFEWSHRSSRSPGAGFKYLKTGT--AKANVSQEAAISRL 118
            |.||:.|.|   .:|.|.|:.           ||  ||.|.:::...||  :.|..|....::..
Zfish    40 PSSLIYPEGMPEGKVTLGCQA-----------RS--SPAAVYRWRVNGTDISFAEESHYTQVAGN 91

  Fly   119 RVLVRPDT---LGEYRCVGWFGPLVVTSTIARLELASTSLVD-AQESESPLQWRVSAGNSVLWSC 179
            .|:..|..   .|.|:|:.......:.|.:|.|:..  .|.| ..||.||  ..|..|.....:|
Zfish    92 LVINNPQNGRDGGSYQCLAINRCGTIVSRVANLKFG--YLRDFPPESRSP--QTVHEGMGTFLAC 152

  Fly   180 GQQVQSNPSASWSYYRNGVE--IKPE----FIG-TNGNLFLSNVSSESSGSYSCQAT-NPASGER 236
             |.....|:.|:.::.|...  |:||    |:. ..|||:|:|..:..:|:|.|..| |.....:
Zfish   153 -QPPAHYPALSYRWFINEFPNFIQPEAGRWFVSQVTGNLYLANARANDTGNYFCFTTINMDVSTK 216

  Fly   237 IQLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSPDVVG 301
            .....::||.|.|:......:|::....|:  |.....|.:..|.|....:|.|.:.|...|  |
Zfish   217 SIFSKAVQLTVHPDASPRKTAPNIRVRFPA--ETYALSGQTAQLECFAYRNPIPKIRWRKVD--G 277

  Fly   302 AVKNK-RSKVFGHALEISNTRVNDAGTYIC--FQDNGVRPALEHYIKVHVEQPPQIVRPPWADLT 363
            .:..| .:.|.|..|.|.....:|.|.|.|  :...|..   .|..:|.|:     .:|.|..:.
Zfish   278 ILPPKVGTSVDGPILIIPELNFDDEGMYECEVYNSEGRE---THQGRVSVQ-----AQPDWLQVM 334

  Fly   364 NEGD-----RLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLKRHAGYVQCFAR 423
            ::.:     .|:..|.|.|.|.|.|.||.|||:.|.....|::|..|.:.::....:|..||.|.
Zfish   335 SDSEVEISSELQWSCAAAGKPRPTIRWLRNGHALITQDRVEVNNGRLKIANLALEDSGMYQCVAE 399

  Fly   424 NRLGEHS-----AGTLLQV-------NPKQIQEPRESGGTHR--------PKPNQ-GSRQKQMYP 467
            |:   ||     |...:||       ||.:...|...||..:        |||.. .||..::. 
Zfish   400 NK---HSTIYSNAELRVQVQAPDFRLNPVRKLVPAARGGQVKMECKPRAAPKPTLFWSRGTELL- 460

  Fly   468 PTPPNVTRL--SDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKN-------------WQTTNDN 517
               .|.||:  :.:.::..:.:.|.|......|...|  :||..:             ...:|.:
Zfish   461 ---TNSTRITVTPDGILWIYNISRADEGKYTCFAENY--LGKANSTGHLSVRDATKITLAPSNAD 520

  Fly   518 IPYGK-------PKWNSELGKSFTASVT----DL-KPQHTYRFRILA-------VYSNNDNKESN 563
            |..|:       ...:..:..:||.|:.    || :|...|| |:..       |..|.....:.
Zfish   521 INQGENATLQCHASHDPTMDLTFTWSLNGVPLDLEEPNGHYR-RMEGKETIGDLVIVNGQLSHAG 584

  Fly   564 T--------------SAKFYLQ--PGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITG 612
            |              |||..::  ||.       |..|.:...::|:|.|.||  ...|.|...|
Zfish   585 TYTCTAQTVVDSAMASAKLVVRGPPGP-------PGGLVVTSVNDTSVELRWS--RGYDNHSPIG 640

  Fly   613 YYAYYRPSSSAGEYFK-----ATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGR 672
            .|.....||...::.:     |.||| :|.|.::..|.....|||::.:.:...:.| .::...|
Zfish   641 KYVILGRSSQTHDWKRMRTDPANIEG-NAESARVIDLRPWMDYEFQVIASNILGSGE-PSMPSPR 703

  Fly   673 TQRPKTSTTEEPT 685
            .|..:.:.|..|:
Zfish   704 AQTKEAAPTVAPS 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 21/84 (25%)
Ig strand B 278..282 CDD:409353 1/3 (33%)
Ig strand C 291..295 CDD:409353 0/3 (0%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/6 (33%)
Ig strand G 341..344 CDD:409353 1/2 (50%)
Ig 352..437 CDD:472250 26/94 (28%)
Ig strand B 369..373 CDD:409353 1/3 (33%)
Ig strand C 382..386 CDD:409353 1/3 (33%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 2/7 (29%)
FN3 467..565 CDD:238020 24/145 (17%)
FN3 582..>655 CDD:238020 23/77 (30%)
cntn2NP_571521.1 Ig 32..128 CDD:472250 25/102 (25%)
Ig strand B 54..58 CDD:409353 2/3 (67%)
Ig strand C 67..71 CDD:409353 0/3 (0%)
Ig strand E 90..94 CDD:409353 0/3 (0%)
Ig strand F 105..110 CDD:409353 2/4 (50%)
Ig strand G 119..122 CDD:409353 1/2 (50%)
Ig 137..225 CDD:472250 23/90 (26%)
Ig strand B 148..152 CDD:409353 0/3 (0%)
Ig strand C 162..166 CDD:409353 1/3 (33%)
Ig strand E 188..192 CDD:409353 3/3 (100%)
Ig strand F 202..207 CDD:409353 2/4 (50%)
Ig strand G 220..223 CDD:409353 0/2 (0%)
Ig 238..325 CDD:472250 23/93 (25%)
Ig strand B 256..260 CDD:409353 1/3 (33%)
Ig strand C 269..273 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 1/3 (33%)
Ig strand F 304..309 CDD:409353 2/4 (50%)
Ig strand G 317..320 CDD:409353 1/2 (50%)
Ig 329..413 CDD:472250 25/86 (29%)
Ig strand B 345..349 CDD:409353 1/3 (33%)
Ig strand C 358..362 CDD:409353 1/3 (33%)
Ig strand E 379..383 CDD:409353 1/3 (33%)
Ig strand F 393..398 CDD:409353 2/4 (50%)
Ig strand G 406..409 CDD:409353 0/2 (0%)
Ig5_Contactin 418..506 CDD:409358 19/93 (20%)
Ig strand A 418..423 CDD:409358 0/4 (0%)
Ig strand A' 426..431 CDD:409358 0/4 (0%)
Ig strand B 435..442 CDD:409358 1/6 (17%)
Ig strand C 450..454 CDD:409358 0/3 (0%)
Ig strand D 468..471 CDD:409358 0/2 (0%)
Ig strand E 472..477 CDD:409358 0/4 (0%)
Ig strand F 485..493 CDD:409358 1/7 (14%)
Ig strand G 499..506 CDD:409358 0/6 (0%)
Ig6_Contactin-2 508..606 CDD:409440 18/98 (18%)
Ig strand A 508..514 CDD:409440 0/5 (0%)
Ig strand A' 517..522 CDD:409440 1/4 (25%)
Ig strand B 525..533 CDD:409440 0/7 (0%)
Ig strand C 542..546 CDD:409440 2/3 (67%)
Ig strand D 567..570 CDD:409440 0/2 (0%)
Ig strand E 571..575 CDD:409440 0/3 (0%)
Ig strand F 584..591 CDD:409440 1/6 (17%)
Ig strand G 598..602 CDD:409440 1/3 (33%)
FN3 615..702 CDD:238020 23/90 (26%)
FN3 <655..1039 CDD:442628 15/64 (23%)
FN3 817..909 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.