DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and Cntn6

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_037357.1 Gene:Cntn6 / 27256 RGDID:62008 Length:1028 Species:Rattus norvegicus


Alignment Length:880 Identity:184/880 - (20%)
Similarity:284/880 - (32%) Gaps:284/880 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LRAPESLVAPLG---DEVVLECETSLQPE-RFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAIS 116
            ::.|:.::.||.   .|::|.|..|..|. .:.|     :..|....:..|...:.: ....|||
  Rat    29 IQEPQDVIFPLDLSRSEIILSCTASGYPSPHYRW-----KQNGTDIDFSMTYHYRLD-GGSLAIS 87

  Fly   117 RLRVLVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNSVLWSCGQ 181
            ..|.   ...:|.|:|:.......:.|..|:|:.|   .::..|::|.....|..|..|:..||.
  Rat    88 SPRT---DQDIGIYQCLATNPVGTILSRKAKLQFA---YIEDFETKSRSTVSVREGQGVVLLCGP 146

  Fly   182 QVQ-SNPSASWSYYRNGV---EIKPEFIGTN-GNLFLSNVSSESSGSYSCQATNPASGERIQLPG 241
            ... ...|..|::..|.:   |.|..|:..| |||:::.|.....|:|:|..||..:...:|.|.
  Rat   147 PPHFGELSYDWTFNDNPLYVQEDKRRFVSQNTGNLYIAKVEPSDVGNYTCFVTNKEAHRSVQGPP 211

  Fly   242 SLQLQVTP------EQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSPD-- 298
            :..:|.|.      |.:.|.:.|         :.|...:.||:.|.|..:|:|.|.:.|...|  
  Rat   212 TPLVQRTDGVMGEYEPKIEVRFP---------ETIQAAKDSSVKLECFALGNPVPDISWRRLDGS 267

  Fly   299 -VVGAVKNKRSKVFGHALEISNTRVNDAGTYICFQDN--GVRPALEHYIKVHVEQPPQIVRPPWA 360
             :.|.||...|:.   .|||...:..|.|.|.|...|  |...|....|   ...||:     |.
  Rat   268 PMPGKVKYSNSQA---TLEIPKFQQEDEGFYECVAGNLRGRNLAKGQLI---FYAPPE-----WE 321

  Fly   361 DLTNEG-----DRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLKRHAGYVQC 420
            ......     |.|..||||:|.|.|...||.||.....:...:..|..||:..:....:|..||
  Rat   322 QKIQNTYLSIYDSLFWECKASGNPNPSYTWLKNGERLNTEERIQTENGTLIITMLNVSDSGIYQC 386

  Fly   421 FARNRLGEHSAGTLLQV---------NP-KQIQEPRESG--------------------GTHRPK 455
            .|.|:.....|...|:|         || |:|...:..|                    ||...|
  Rat   387 AAENKYQTIYANAELRVLASAPDFSKNPIKKISVVQVGGDISIECKPNAFPKASISWKRGTENLK 451

  Fly   456 ----------------------------------------------------------------- 455
                                                                             
  Rat   452 QSKRVFFLEDGSLKICNVTRSDAGSYTCVATNQFGNGKSSGSLIVKERTVITVPPSKMDVTVGES 516

  Fly   456 ---PNQGSRQKQMY--------------------------------------------------- 466
               |.|.|....|.                                                   
  Rat   517 IVLPCQVSHDPTMEVLFVWYFNGDVIDLKKGVAHFERIGGESVGDLMIRNIQLGHSGKYLCTVQT 581

  Fly   467 ---------------PPTPP---NVTRLSDESVMLRWMVPRNDGLPIVIFKVQYR---MVGKRKN 510
                           ||.||   .|..:|..:..|.|....::..||.||.:|.|   .||    
  Rat   582 TLERLSAVADIIVRGPPGPPEDVKVEHISSTTSQLSWRPGPDNNSPIQIFTIQTRTPFSVG---- 642

  Fly   511 WQTTNDNIPYGKPKWNSEL--GKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPG 573
            ||.. ..:|        |:  |:::.|:|..|.|...|.||::|  .||......:.....|:..
  Rat   643 WQAV-ATVP--------EILNGQTYNATVIGLSPWVEYEFRVVA--GNNIGIGEPSKPSELLRTK 696

  Fly   574 AALDPMPVPELLEIEEYSETAVVLHWS-LASDADEHLITGYYAYYRPSSSAGEYFK---ATIEGA 634
            |:: |...|..:.....|.:.:|:.|. :..:.......||...:||..|. .:.|   |.:|.:
  Rat   697 ASI-PNVAPVNINGGGGSRSELVITWEPIPEELQNGEGFGYIIMFRPVGST-TWMKEKVALVESS 759

  Fly   635 H--ARSFKIAPLETATMYEFKLQSFS---AASASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTT 694
            .  .|:..|.||   :.:|.|:..::   ..|.|..|.:..|.         :||  ::..|.|:
  Rat   760 KFIYRNESIMPL---SPFEVKVGVYNNEGEGSLSTVSIVYSGE---------DEP--RLAPRGTS 810

  Fly   695 TPSHNETFNMSPM-----------LTGTIGGGAVL 718
            .    ::|:.|.|           .||.:.|..||
  Rat   811 V----QSFSASDMEVSWNAIAWNRNTGRVLGYEVL 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 25/86 (29%)
Ig strand B 278..282 CDD:409353 1/3 (33%)
Ig strand C 291..295 CDD:409353 0/3 (0%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 25/89 (28%)
Ig strand B 369..373 CDD:409353 1/3 (33%)
Ig strand C 382..386 CDD:409353 0/3 (0%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
FN3 467..565 CDD:238020 31/105 (30%)
FN3 582..>655 CDD:238020 18/78 (23%)
Cntn6NP_037357.1 Ig 26..120 CDD:472250 22/102 (22%)
Ig strand B 46..50 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 1/8 (13%)
Ig strand E 82..86 CDD:409353 0/3 (0%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 1/2 (50%)
Ig 129..214 CDD:472250 23/84 (27%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 1/3 (33%)
Ig strand E 179..183 CDD:409353 3/3 (100%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 27/102 (26%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/6 (17%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 1/2 (50%)
Ig 319..403 CDD:472250 24/88 (27%)
Ig strand B 335..339 CDD:143205 1/3 (33%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 1/3 (33%)
Ig strand F 383..388 CDD:143205 2/4 (50%)
Ig strand G 396..399 CDD:143205 1/2 (50%)
Ig5_Contactin 408..496 CDD:409358 8/87 (9%)
Ig strand A 408..413 CDD:409358 0/4 (0%)
Ig strand A' 416..421 CDD:409358 2/4 (50%)
Ig strand B 425..432 CDD:409358 1/6 (17%)
Ig strand C 440..444 CDD:409358 0/3 (0%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 0/4 (0%)
Ig strand F 475..483 CDD:409358 0/7 (0%)
Ig strand G 489..496 CDD:409358 0/6 (0%)
Ig 500..598 CDD:472250 4/97 (4%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 0/3 (0%)
Ig strand F 574..579 CDD:409353 0/4 (0%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
FN3 598..691 CDD:238020 30/107 (28%)
FN3 <620..>912 CDD:442628 60/257 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.