DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and neo1a

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:XP_009301739.1 Gene:neo1a / 266983 ZFINID:ZDB-GENE-021031-1 Length:1450 Species:Danio rerio


Alignment Length:702 Identity:163/702 - (23%)
Similarity:259/702 - (36%) Gaps:140/702 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PESLVAPLGDEVVLECET-SLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISRLRVLV 122
            |...:|..|..|:|.|.. |..|.:.||.              |.|:..:..|.|    |.:||.
Zfish    40 PSDTLAVRGAPVLLNCSVHSESPAKIEWK--------------KDGSFLSLASDE----RRQVLA 86

  Fly   123 ---------------RPDTLGEYRCVGWFGPL-VVTSTIARLELASTSLVDAQESESPLQWRVSA 171
                           :||. |.|:||.....| .:.|..|||.:|..    |:....|....|..
Zfish    87 DGSLLISSVVHSKHNKPDE-GVYQCVATIDNLGTIISRTARLNVAGI----ARFLSQPEMASVRV 146

  Fly   172 GNSVLWSCGQQVQSNPS----ASWSYYRNGVEIKPE-FIGTNGNLFLSNVSSESSGSYSCQATNP 231
            |:|.:.||    :.||.    ..|...:..||:... |...:|.|.:||.:...:|.|.|...|.
Zfish   147 GDSQVLSC----EVNPDLVSFIRWEQNKEAVELDHRVFSLPSGALVISNATETDAGLYRCVIDNA 207

  Fly   232 ASGERIQLPGSLQLQVTPEQRSESKSPHLL--RGQPSS-------QEITIREGSSLLLLCPGVGS 287
            .                |.:.||....|:|  .|:..:       |.::...|.|:||.|...|.
Zfish   208 G----------------PTKTSEEAQLHILTETGEERTLEFLQEPQHVSKLVGESVLLPCVVTGY 256

  Fly   288 PPPTVVWSSPDVVGAVKNKRSKVF-GHALEISNTRVNDAGTYICFQDNGVRPALEHYIKVHVEQP 351
            |.|.:.|...|.:....:.|.::. |.:|.|.|....|||.|.|..:| ...::|...::.::..
Zfish   257 PTPEITWMYKDQLIEDSSGRFEILGGGSLRIFNLTEEDAGVYNCLAEN-TNGSIEAQAELTLKDS 320

  Fly   352 PQIVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAEL--SNNFLILHSVLKRH 414
            ||.::.|.....:|...:..||:.:|.|:|.|.|:.||.:.|.....::  ..|..:| .::|..
Zfish   321 PQFLKKPVNVFAHEATDVIFECEVSGSPSPTIKWVKNGDAVIPSDYFKIIKEQNLQVL-GLVKSD 384

  Fly   415 AGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRESGGTHRPKPNQ-----------GSRQKQMYPP 468
            .|:.||.|.|..|...:...|.:..:.:..|       .|:|..           |||......|
Zfish   385 EGFYQCLAENDAGNVQSSAQLVILDQDVTLP-------LPRPTSLTRATTDRLMPGSRGGAGPTP 442

  Fly   469 TPPN---VTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELG 530
            :.|.   .:.:|...:.|.|.:|.......|.:.|.|.:.|      |..:.|.      |:...
Zfish   443 SAPRDVVASLVSTRFLKLTWRLPAEPHGDDVTYSVYYSLEG------TNRERIV------NTSRP 495

  Fly   531 KSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAV 595
            .....::.:|.|...|.||::| ::.|...||:...|...||...: |.|.|.|..: ..|.:.|
Zfish   496 GEMQVTIQNLMPDTKYAFRVVA-HNKNGPGESSVPLKVETQPEVQV-PGPAPNLHAV-VMSPSTV 557

  Fly   596 VLHWS--LASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFS 658
            .|.|.  |..:.:   |..|..||.......|...    ..:..|:.:..|:..|.|.|:|.:::
Zfish   558 SLSWDVPLIGNGE---IQNYKIYYMEKGMDSEQDL----DVNTLSYTMTGLKKFTEYSFRLVAYN 615

  Fly   659 AASASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTTTPSHN--ETFNMSPML 708
                      |.|    |..||.:.......|..::.|.:.  |..|...::
Zfish   616 ----------KHG----PGVSTEDISVRTYSDVPSSPPQNMTVEVLNSKSLM 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 23/89 (26%)
Ig strand B 278..282 CDD:409353 2/3 (67%)
Ig strand C 291..295 CDD:409353 0/3 (0%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 1/2 (50%)
Ig 352..437 CDD:472250 24/86 (28%)
Ig strand B 369..373 CDD:409353 0/3 (0%)
Ig strand C 382..386 CDD:409353 1/3 (33%)
Ig strand E 404..407 CDD:409353 0/2 (0%)
Ig strand F 417..422 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
FN3 467..565 CDD:238020 22/100 (22%)
FN3 582..>655 CDD:238020 17/74 (23%)
neo1aXP_009301739.1 IgI_1_Neogenin_like 33..129 CDD:409387 28/107 (26%)
Ig strand A 33..36 CDD:409387
Ig strand A' 39..45 CDD:409387 1/4 (25%)
Ig strand B 49..59 CDD:409387 3/9 (33%)
Ig strand C 63..69 CDD:409387 2/19 (11%)
Ig strand C' 71..74 CDD:409387 1/2 (50%)
Ig strand D 81..86 CDD:409387 2/4 (50%)
Ig strand E 88..94 CDD:409387 0/5 (0%)
Ig strand F 106..113 CDD:409387 4/6 (67%)
Ig strand G 118..129 CDD:409387 4/10 (40%)
IG_like 143..220 CDD:214653 22/96 (23%)
Ig strand B 151..154 CDD:409353 0/2 (0%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand E 185..189 CDD:409353 2/3 (67%)
Ig strand F 199..204 CDD:409353 2/4 (50%)
Ig strand G 213..216 CDD:409353 2/2 (100%)
I-set 231..316 CDD:400151 23/85 (27%)
Ig strand B 247..251 CDD:409353 2/3 (67%)
Ig strand C 260..264 CDD:409353 0/3 (0%)
Ig strand E 283..287 CDD:409353 1/3 (33%)
Ig strand F 297..302 CDD:409353 2/4 (50%)
Ig strand G 310..313 CDD:409353 1/2 (50%)
IgI_4_Neogenin_like 324..407 CDD:409388 22/83 (27%)
Ig strand A 324..327 CDD:409388 0/2 (0%)
Ig strand A' 329..333 CDD:409388 0/3 (0%)
Ig strand B 336..345 CDD:409388 2/8 (25%)
Ig strand C 350..356 CDD:409388 3/5 (60%)
Ig strand C' 358..361 CDD:409388 1/2 (50%)
Ig strand D 366..370 CDD:409388 0/3 (0%)
Ig strand E 374..378 CDD:409388 1/3 (33%)
Ig strand F 386..394 CDD:409388 4/7 (57%)
Ig strand G 397..407 CDD:409388 2/9 (22%)
FN3 <436..852 CDD:442628 54/254 (21%)
FN3 712..>1061 CDD:442628
Neogenin_C 1157..1450 CDD:461954
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.