DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and MXRA5

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_056234.2 Gene:MXRA5 / 25878 HGNCID:7539 Length:2828 Species:Homo sapiens


Alignment Length:760 Identity:169/760 - (22%)
Similarity:266/760 - (35%) Gaps:208/760 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LGDEVVLECETS---------LQPERFEWSHRSSRSPGAGFKYL---KTGTAKANVSQEAAISRL 118
            |||.:.:||...         :.|:|..|   .:.||..|...|   :|.:.|     ||:.|  
Human  1964 LGDTIAMECLAKGTPAPQISWIFPDRRVW---QTVSPVEGRITLHENRTLSIK-----EASFS-- 2018

  Fly   119 RVLVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNSVLWSCGQQV 183
                   ..|.|:||. .......|...||.:|:...|..||....:.  :..|.|:...|..:.
Human  2019 -------DRGVYKCVA-SNAAGADSLAIRLHVAALPPVIHQEKLENIS--LPPGLSIHIHCTAKA 2073

  Fly   184 QSNPSASWSYYRNGVEIKPE-------FIGTNGNLFLSNVSSESSGSYSCQATNPASGERIQLPG 241
            ...||..| ...:|.:|:|.       |:..||.|::.|::.:.||.|.|.|.|.....|    .
Human  2074 APLPSVRW-VLGDGTQIRPSQFLHGNLFVFPNGTLYIRNLAPKDSGRYECVAANLVGSAR----R 2133

  Fly   242 SLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSPD--VVGAV- 303
            ::||.|   ||:.:.:  .:.| .|.:...:|.|.:|.|.|...|.|.|.::|..|.  ::.|: 
Human  2134 TVQLNV---QRAAANA--RITG-TSPRRTDVRYGGTLKLDCSASGDPWPRILWRLPSKRMIDALF 2192

  Fly   304 -KNKRSKVFGH-ALEISNTRVNDAGTYICFQDNGVRPALEHYIKVHVEQPPQIVRPPWADLTNEG 366
             .:.|.|||.: .|.:.:....|||.|:|...|.|.   :.|:.:.|:   .:::|...:...|.
Human  2193 SFDSRIKVFANGTLVVKSVTDKDAGDYLCVARNKVG---DDYVVLKVD---VVMKPAKIEHKEEN 2251

  Fly   367 DR-------LKLECKATGVPTPEIYW------LLNGHSSIDDSEAE------LSNNFLILHSVLK 412
            |.       ||::|.|||:|.|||.|      |:|.....|||...      .:|..|..:.|..
Human  2252 DHKVFYGGDLKVDCVATGLPNPEISWSLPDGSLVNSFMQSDDSGGRTKRYVVFNNGTLYFNEVGM 2316

  Fly   413 RHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPR----------------------ESGGTHRPK 455
            |..|...|||.|::|:..    ::|..|.:..|.                      |:.|...||
Human  2317 REEGDYTCFAENQVGKDE----MRVRVKVVTAPATIRNKTYLAVQVPYGDVVTVACEAKGEPMPK 2377

  Fly   456 PNQGSRQKQMYPPTPPNVTRLSDESVMLR-------------------------WM-----VPRN 490
            ....|...::.|.:........|.:::::                         |:     .|:.
Human  2378 VTWLSPTNKVIPTSSEKYQIYQDGTLLIQKAQRSDSGNYTCLVRNSAGEDRKTVWIHVNVQPPKI 2442

  Fly   491 DGLPIVIFKV-QYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRI---- 550
            :|.|..|..| :....|.||......:.||..:..|      :|...|....|.:..|..:    
Human  2443 NGNPNPITTVREIAAGGSRKLIDCKAEGIPTPRVLW------AFPEGVVLPAPYYGNRITVHGNG 2501

  Fly   551 --------------LAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLH--- 598
                          |...:.|:..|    |:..||. ..|:||..|...:......||:..|   
Human  2502 SLDIRSLRKSDSVQLVCMARNEGGE----ARLILQL-TVLEPMEKPIFHDPISEKITAMAGHTIS 2561

  Fly   599 --------------WSLASDADEHLITGYYA---YYR----------PSSSAGEYFKATIEGAHA 636
                          |.|.:..|  |.:|...   |::          .|..||.| :.....|..
Human  2562 LNCSAAGTPTPSLVWVLPNGTD--LQSGQQLQRFYHKADGMLHISGLSSVDAGAY-RCVARNAAG 2623

  Fly   637 RSFKIAPLETATMYEFKLQSFSAASASEFSALK---------QGR 672
            .:.::..|:.....|...|..:..|......||         |||
Human  2624 HTERLVSLKVGLKPEANKQYHNLVSIINGETLKLPCTPPGAGQGR 2668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 25/86 (29%)
Ig strand B 278..282 CDD:409353 2/3 (67%)
Ig strand C 291..295 CDD:409353 0/3 (0%)
Ig strand E 313..317 CDD:409353 1/4 (25%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 29/103 (28%)
Ig strand B 369..373 CDD:409353 2/3 (67%)
Ig strand C 382..386 CDD:409353 3/9 (33%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
FN3 467..565 CDD:238020 21/146 (14%)
FN3 582..>655 CDD:238020 17/102 (17%)
MXRA5NP_056234.2 leucine-rich repeat 38..55 CDD:275380
LRR <46..>218 CDD:443914
LRR 1 56..77
leucine-rich repeat 57..80 CDD:275380
LRR 2 80..101
leucine-rich repeat 81..104 CDD:275380
LRR 3 104..125
leucine-rich repeat 105..128 CDD:275380
LRR 4 128..149
leucine-rich repeat 129..152 CDD:275380
LRR 5 152..173
leucine-rich repeat 153..184 CDD:275380
LRR 6 184..205
leucine-rich repeat 185..208 CDD:275380
LRRCT 217..>263 CDD:214507
IG_like 486..572 CDD:214653
Ig strand B 497..501 CDD:409353
Ig strand C 510..515 CDD:409353
Ig strand E 538..542 CDD:409353
Ig strand F 552..557 CDD:409353
IG_like 590..668 CDD:214653
Ig strand B 595..599 CDD:409353
Ig strand C 608..612 CDD:409353
Ig strand E 634..638 CDD:409353
Ig strand F 648..653 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..715
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 933..962
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1068..1190
DUF5585 1181..>1561 CDD:465521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1204..1275
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1367..1389
LRR 7 1410..1434
PHA03247 <1465..1799 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1479..1499
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1536..1566
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1579..1603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1669..1689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1700..1719
Ig_3 1852..1932 CDD:464046
Ig 1958..2042 CDD:472250 24/95 (25%)
Ig strand B 1968..1972 CDD:409353 0/3 (0%)
Ig strand C 1981..1985 CDD:409353 0/3 (0%)
Ig strand E 2008..2012 CDD:409353 1/3 (33%)
Ig strand F 2022..2027 CDD:409353 2/4 (50%)
Ig strand G 2035..2038 CDD:409353 1/2 (50%)
Ig 2065..2137 CDD:472250 19/76 (25%)
Ig strand B 2065..2069 CDD:409353 0/3 (0%)
Ig strand C 2078..2082 CDD:409353 2/4 (50%)
Ig strand E 2105..2109 CDD:409353 2/3 (67%)
Ig strand F 2119..2124 CDD:409353 2/4 (50%)
Ig strand G 2133..2136 CDD:409353 0/2 (0%)
Ig_3 2147..2225 CDD:464046 23/78 (29%)
IG_like 2258..2341 CDD:214653 27/86 (31%)
Ig strand C 2274..2278 CDD:409353 2/3 (67%)
Ig strand E 2307..2311 CDD:409353 1/3 (33%)
Ig strand F 2321..2326 CDD:409353 1/4 (25%)
Ig 2356..2431 CDD:472250 7/74 (9%)
Ig strand B 2364..2368 CDD:409353 0/3 (0%)
Ig strand C 2377..2381 CDD:409353 1/3 (33%)
Ig strand E 2401..2405 CDD:409353 0/3 (0%)
Ig strand F 2415..2420 CDD:409353 0/4 (0%)
Ig strand G 2428..2431 CDD:409353 0/2 (0%)
Ig 2457..2535 CDD:472250 16/88 (18%)
Ig strand B 2462..2466 CDD:409353 1/3 (33%)
Ig strand C 2475..2480 CDD:409353 1/10 (10%)
Ig strand E 2501..2505 CDD:409353 0/3 (0%)
Ig strand F 2515..2520 CDD:409353 1/4 (25%)
Ig strand G 2528..2531 CDD:409353 0/2 (0%)
IG_like 2549..2633 CDD:214653 15/86 (17%)
Ig strand B 2560..2564 CDD:409568 0/3 (0%)
Ig strand C 2573..2577 CDD:409568 0/3 (0%)
Ig strand E 2599..2603 CDD:409568 0/3 (0%)
Ig strand F 2613..2618 CDD:409568 1/5 (20%)
Ig strand G 2626..2629 CDD:409568 0/2 (0%)
IG_like 2652..2728 CDD:214653 5/17 (29%)
Ig strand B 2655..2659 CDD:409353 2/3 (67%)
Ig strand C 2668..2672 CDD:409353 1/1 (100%)
Ig strand E 2694..2698 CDD:409353
Ig strand F 2708..2713 CDD:409353
Ig_3 2732..2814 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.