DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and HMCN2

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001278744.1 Gene:HMCN2 / 256158 HGNCID:21293 Length:5079 Species:Homo sapiens


Alignment Length:799 Identity:169/799 - (21%)
Similarity:258/799 - (32%) Gaps:245/799 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RILRAPESLVAPLGDEVVLECE-TSLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISR 117
            ::...|..:...||...:|.|. |...|....|.....:..|     |:.|..:.:.|::.... 
Human   787 QLTELPRDVTVELGRSALLACRATGRPPPTVTWRRGDGQPLG-----LRLGAGRGSRSRQPDSG- 845

  Fly   118 LRVL----VRPDTLGEYRCV--GWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNSVL 176
              ||    |.|:....|.|.  ..||.:.     |...|..|.....|.:.|....||..|..|.
Human   846 --VLFFESVAPEDQAPYVCEARNVFGKVQ-----AEARLIVTGHAPPQIASSAPTVRVLEGQPVS 903

  Fly   177 WSC----GQQVQSNPSASWSYYRNGVEIKP---EFIGTNGNLFLSNVSSESSGSYSCQATNPASG 234
            ..|    |:.:   |...|  .::|..:.|   ..|..:|:|.|.....|.:|.|||.|||.|..
Human   904 LPCIVLAGRPL---PERHW--LKDGRPLPPGSRHSIRADGSLHLDRALQEHAGRYSCVATNTAGS 963

  Fly   235 ER------IQLPGSLQLQVTPEQRSE----------------------------SKSPH------ 259
            :.      :|:|..:....|....:|                            |:.||      
Human   964 QHRDVELVVQVPPRIHPTATHHITNEGVAASLPCVASGVPAPTITWTKETNALTSRGPHYNVSKE 1028

  Fly   260 --LLRGQPSSQ------------------------------------------EITIREGSSLLL 280
              ||..|||:|                                          ::|.:.|..:.|
Human  1029 GTLLIAQPSAQDAGAYVCTATNTVGFSSQEMRLSVNTKPRIHMNGSRNADVPLQVTAKAGEEVTL 1093

  Fly   281 LCPGVGSPPPTVVW---SSPDVVGAVKNKRSKVFGHALEISNTRVNDAGTYICFQDNGVRPALEH 342
            .|...|||||.|.|   |.|  |..:.|:...:...:|.::..:|.|:|.|.|...|....|...
Human  1094 DCEAKGSPPPLVTWTKDSRP--VPPITNRYGLLPSGSLRLAQVQVGDSGHYECTASNPAGSASHR 1156

  Fly   343 YIKVHVEQPPQIVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLIL 407
            |: :.|:.|||:...|.......|:.|.|.|.|.|.|.|::.|..:| ..:.....:.|.:|..:
Human  1157 YV-LGVQVPPQVQPGPRVLKVLVGEALDLNCVAEGNPEPQLSWSKDG-VVLQGRGPQGSVHFAAI 1219

  Fly   408 HSVLKRHAGYVQCFARNRLG------------------EHSAGTLLQVNPKQIQEPRESGGTHRP 454
            .:   ..||..:|.|.|..|                  :.::|.|.:|..:....|..:.||  |
Human  1220 RT---SDAGRYRCEASNSAGVDAWEVELRVLEPPHWGADETSGLLERVAGENASLPCPARGT--P 1279

  Fly   455 KPNQGSRQKQMYPPT--PPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDN 517
            ||....|:.....|.  .|.|..|.:.|:.|..:.|.:.|        .|..       |.||  
Human  1280 KPQVTWRKGPSSEPLHGQPGVAVLEEGSLFLASVSPADSG--------DYEC-------QATN-- 1327

  Fly   518 IPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVY----SNNDNKESNTSAKFYLQPGAAL-- 576
                      |:|.             |.|...|.||    ...|.:::|.|.    ..|.:|  
Human  1328 ----------EVGS-------------TSRRAKLVVYVPPSIREDGRKANVSG----MAGQSLTL 1365

  Fly   577 ----DPMPVPELLEIEEYS-----------ETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEY 626
                :..||||::.:::..           :....||:....:.|    :|.|: .|..:.|   
Human  1366 ECDANGFPVPEIVWLKDAQLIPKVGGHRLLDEGQSLHFPRIQEGD----SGLYS-CRAENQA--- 1422

  Fly   627 FKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRPKTSTTEEPTLQMGDR 691
                  |...|.|.:..|...::       ..|.:|.|...|.....:           ||....
Human  1423 ------GTAQRDFHLLVLTPPSV-------LGAGAAQEVLGLAGADVE-----------LQCWTS 1463

  Fly   692 DTTTPSHNETFNMSPMLTG 710
            ...||....|.:..|:|.|
Human  1464 GVPTPQVEWTKDRQPVLPG 1482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 26/126 (21%)
Ig strand B 278..282 CDD:409353 1/3 (33%)
Ig strand C 291..295 CDD:409353 2/6 (33%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 23/102 (23%)
Ig strand B 369..373 CDD:409353 2/3 (67%)
Ig strand C 382..386 CDD:409353 0/3 (0%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
FN3 467..565 CDD:238020 21/103 (20%)
FN3 582..>655 CDD:238020 13/83 (16%)
HMCN2NP_001278744.1 ChlD <3..207 CDD:440853
IG_like 434..513 CDD:214653
IG_like 524..604 CDD:214653
Ig strand B 534..538 CDD:409353
Ig strand C 547..551 CDD:409353
Ig strand E 570..574 CDD:409353
Ig strand F 584..589 CDD:409353
Ig strand G 597..600 CDD:409353
I-set 608..692 CDD:400151
Ig strand B 625..629 CDD:409353
Ig strand C 638..642 CDD:409353
Ig strand E 660..664 CDD:409353
Ig strand F 674..679 CDD:409353
Ig strand G 687..690 CDD:409353
IG_like 712..782 CDD:214653
Ig strand B 715..719 CDD:409353
Ig strand C 728..732 CDD:409353
Ig strand E 748..752 CDD:409353
Ig strand F 762..767 CDD:409353
IG_like 792..879 CDD:214653 22/99 (22%)
Ig strand B 803..807 CDD:409353 1/3 (33%)
Ig strand C 816..820 CDD:409353 0/3 (0%)
Ig strand E 845..849 CDD:409353 2/6 (33%)
Ig strand F 859..864 CDD:409353 2/4 (50%)
Ig strand G 872..875 CDD:409353 1/7 (14%)
I-set 885..972 CDD:400151 25/91 (27%)
Ig strand B 902..906 CDD:409353 1/3 (33%)
Ig strand C 916..920 CDD:409353 1/5 (20%)
Ig strand F 952..957 CDD:409353 3/4 (75%)
Ig strand G 965..968 CDD:409353 0/2 (0%)
Ig_3 975..1050 CDD:464046 12/74 (16%)
Ig 1080..1161 CDD:472250 24/83 (29%)
Ig strand B 1091..1095 CDD:409353 1/3 (33%)
Ig strand C 1104..1108 CDD:409353 1/3 (33%)
Ig strand E 1127..1131 CDD:409353 1/3 (33%)
Ig strand F 1141..1146 CDD:409353 2/4 (50%)
Ig strand G 1154..1157 CDD:409353 0/2 (0%)
Ig 1165..1246 CDD:472250 21/84 (25%)
Ig strand B 1182..1186 CDD:409353 2/3 (67%)
Ig strand C 1195..1199 CDD:409353 0/3 (0%)
Ig strand E 1212..1216 CDD:409353 1/3 (33%)
Ig strand F 1226..1231 CDD:409353 1/4 (25%)
Ig strand G 1239..1242 CDD:409353 0/2 (0%)
IG_like 1258..1340 CDD:214653 27/123 (22%)
Ig strand B 1269..1273 CDD:409353 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1271..1298 8/28 (29%)
Ig strand C 1282..1286 CDD:409353 0/3 (0%)
Ig strand E 1306..1310 CDD:409353 1/3 (33%)
Ig strand F 1320..1325 CDD:409353 1/11 (9%)
I-set 1354..1433 CDD:400151 18/96 (19%)
Ig strand B 1363..1367 CDD:409353 1/3 (33%)
Ig strand C 1376..1380 CDD:409353 1/3 (33%)
Ig strand E 1399..1403 CDD:409353 1/3 (33%)
Ig strand F 1413..1418 CDD:409353 1/5 (20%)
Ig strand G 1426..1429 CDD:409353 1/2 (50%)
IG_like 1446..1527 CDD:214653 10/48 (21%)
Ig strand B 1456..1460 CDD:409353 1/14 (7%)
Ig strand C 1469..1473 CDD:409353 0/3 (0%)
Ig strand E 1492..1497 CDD:409353
Ig strand F 1507..1512 CDD:409353
I-set 1542..1620 CDD:400151
Ig strand B 1543..1554 CDD:409353
Ig strand C 1563..1567 CDD:409353
Ig strand E 1586..1590 CDD:409353
Ig strand F 1600..1605 CDD:409353
Ig 1632..1705 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
I-set 1729..1807 CDD:400151
Ig strand B 1737..1741 CDD:409353
Ig strand C 1750..1754 CDD:409353
Ig strand E 1772..1777 CDD:409353
Ig strand F 1787..1792 CDD:409353
Ig strand G 1800..1803 CDD:409353
Ig 1820..1893 CDD:472250
Ig strand B 1829..1833 CDD:409353
Ig strand C 1842..1846 CDD:409353
Ig strand E 1857..1861 CDD:409353
Ig strand F 1871..1876 CDD:409353
Ig strand G 1884..1887 CDD:409353
I-set 1895..1975 CDD:400151
Ig strand B 1912..1916 CDD:409353
Ig strand C 1925..1929 CDD:409353
Ig strand E 1948..1952 CDD:409353
Ig strand F 1962..1967 CDD:409353
Ig strand G 1975..1978 CDD:409353
Ig_3 1985..2061 CDD:464046
Ig_3 2079..2154 CDD:464046
Ig 2171..2261 CDD:472250
Ig strand B 2189..2193 CDD:409353
Ig strand C 2202..2206 CDD:409353
Ig strand E 2227..2231 CDD:409353
Ig strand F 2241..2246 CDD:409353
Ig strand G 2254..2257 CDD:409353
I-set 2273..2355 CDD:400151
Ig strand B 2285..2289 CDD:409353
Ig strand C 2298..2302 CDD:409353
Ig strand E 2320..2325 CDD:409353
Ig strand F 2335..2340 CDD:409353
Ig 2367..2449 CDD:472250
Ig strand B 2379..2383 CDD:409353
Ig strand C 2392..2396 CDD:409353
Ig strand E 2415..2419 CDD:409353
Ig strand F 2429..2434 CDD:409353
Ig strand G 2442..2445 CDD:409353
I-set 2464..2542 CDD:400151
Ig strand B 2472..2476 CDD:409353
Ig strand C 2485..2489 CDD:409353
Ig strand E 2508..2512 CDD:409353
Ig strand F 2522..2527 CDD:409353
Ig strand G 2535..2538 CDD:409353
I-set 2560..2638 CDD:400151
Ig strand B 2568..2572 CDD:409353
Ig strand C 2581..2585 CDD:409353
Ig strand E 2604..2608 CDD:409353
Ig strand F 2618..2623 CDD:409353
I-set 2656..2728 CDD:400151
Ig strand B 2666..2670 CDD:409353
Ig strand C 2679..2683 CDD:409353
Ig strand E 2702..2706 CDD:409353
Ig strand F 2716..2721 CDD:409353
Ig 2770..2847 CDD:472250
Ig strand B 2777..2781 CDD:409353
Ig strand C 2790..2794 CDD:409353
Ig strand E 2814..2817 CDD:409353
Ig strand F 2827..2832 CDD:409353
Ig strand G 2840..2843 CDD:409353
I-set 2864..2942 CDD:400151
Ig strand B 2872..2876 CDD:409353
Ig strand C 2885..2889 CDD:409353
Ig strand E 2907..2912 CDD:409353
Ig strand F 2922..2927 CDD:409353
IG_like 2954..3034 CDD:214653
Ig strand B 2964..2968 CDD:409353
Ig strand C 2977..2981 CDD:409353
Ig strand E 3000..3004 CDD:409353
Ig strand F 3014..3019 CDD:409353
I-set 3038..3129 CDD:400151
Ig strand B 3059..3063 CDD:409353
Ig strand C 3072..3076 CDD:409353
Ig strand E 3095..3099 CDD:409353
Ig strand F 3109..3114 CDD:409353
Ig_3 3132..3208 CDD:464046
I-set 3238..3308 CDD:400151
Ig strand B 3244..3248 CDD:409353
Ig strand C 3257..3261 CDD:409353
Ig strand E 3282..3286 CDD:409353
Ig strand F 3296..3301 CDD:409353
I-set 3335..3410 CDD:400151
Ig strand B 3340..3344 CDD:409353
Ig strand C 3353..3357 CDD:409353
Ig strand E 3376..3380 CDD:409353
Ig strand F 3390..3395 CDD:409353
Ig 3424..3499 CDD:472250
Ig strand B 3433..3437 CDD:409353
Ig strand C 3446..3450 CDD:409353
Ig strand E 3464..3469 CDD:409353
Ig strand F 3479..3484 CDD:409353
Ig strand G 3492..3495 CDD:409353
Ig 3503..3590 CDD:472250
Ig strand B 3522..3526 CDD:409353
Ig strand C 3535..3539 CDD:409353
Ig strand E 3556..3560 CDD:409353
Ig strand F 3570..3575 CDD:409353
Ig strand G 3583..3586 CDD:409353
Ig 3602..3683 CDD:472250
Ig strand C 3626..3630 CDD:409353
Ig strand E 3648..3653 CDD:409353
Ig strand F 3663..3668 CDD:409353
Ig 3689..3765 CDD:472250
Ig strand B 3704..3708 CDD:409353
Ig strand C 3717..3721 CDD:409353
Ig strand E 3740..3744 CDD:409353
Ig strand F 3754..3759 CDD:409353
Ig_3 3777..3854 CDD:464046
Ig 3873..3958 CDD:472250
Ig strand B 3888..3892 CDD:409353
Ig strand C 3901..3905 CDD:409353
Ig strand E 3924..3928 CDD:409353
Ig strand F 3938..3943 CDD:409353
Ig strand G 3951..3954 CDD:409353
Ig_3 3962..4035 CDD:464046
I-set 4052..4139 CDD:400151
Ig strand B 4069..4073 CDD:409353
Ig strand C 4082..4086 CDD:409353
Ig strand E 4105..4109 CDD:409353
Ig strand F 4119..4124 CDD:409353
Ig strand G 4132..4135 CDD:409353
I-set 4143..4228 CDD:400151
Ig strand B 4160..4164 CDD:409353
Ig strand C 4173..4177 CDD:409353
Ig strand E 4194..4198 CDD:409353
Ig strand F 4208..4213 CDD:409353
Ig strand G 4223..4226 CDD:409353
I-set 4246..4317 CDD:400151
Ig strand B 4250..4254 CDD:409353
Ig strand C 4263..4267 CDD:409353
Ig strand E 4285..4289 CDD:409353
Ig strand F 4299..4304 CDD:409353
Ig 4324..4409 CDD:472250
Ig strand B 4340..4344 CDD:409353
Ig strand C 4353..4357 CDD:409353
Ig strand E 4375..4379 CDD:409353
Ig strand F 4389..4394 CDD:409353
Ig strand G 4402..4405 CDD:409353
nidG2 4411..4625 CDD:469646
FXa_inhibition 4652..4687 CDD:464251
EGF_CA 4689..4732 CDD:214542
EGF_CA 4733..4766 CDD:214542
EGF_CA 4776..4805 CDD:429571
EGF_CA 4883..4922 CDD:214542
EGF_CA 4923..4963 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.