DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and DSCAM

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:687 Identity:152/687 - (22%)
Similarity:259/687 - (37%) Gaps:158/687 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GVRILRAPESLVAPLGDEVVLECETSLQP-ERFEWSHRSSRSPGAGFKYLK-----TGTAK-ANV 109
            |...:|..:::.|..|.:..:.|.....| ...:|...|:..|   |.:.:     .||.| ::|
Human   503 GPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSNLLP---FNHRQVAFENNGTLKLSDV 564

  Fly   110 SQEAAISRLRVLVRPDTLGEYRCVGWFGPLVVTSTIARLELASTSLVDAQESESPLQWRVSAGNS 174
            .:|.            ..|||.|.....|.:.||....:.:.....:  |..|.|   |.|.|..
Human   565 QKEV------------DEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI--QPFEFP---RFSIGQR 612

  Fly   175 VLWSCGQQVQSNPSASWSYYRNGVEIKPEFIGT-------NGNLFLSNVSSESSGSYSCQATNPA 232
            |...| ..|..:...:.::.::|..| |..:|.       ..:|.:||:|...:|:|:|.|.|.|
Human   613 VFIPC-VVVSGDLPITITWQKDGRPI-PGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEA 675

  Fly   233 SGERIQLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSP 297
            :.  ::....|.::|.|:          ...||..|:...  |.:::|.|...|.|.||:||...
Human   676 AA--VEHQSQLIVRVPPK----------FVVQPRDQDGIY--GKAVILNCSAEGYPVPTIVWKFS 726

  Fly   298 DVVGAVK------NKRSKVFGH-ALEISNTRVNDAGTYICFQDNGVRPALEHYIKVHVEQPPQIV 355
            ...|..:      |.|.:|..: :|.|.:....|:|.|:|...|.|...:...:.:.|:.|..|.
Human   727 KGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMIT 791

  Fly   356 RPPWADLTNEGDRLKLECKATGVPTPEIYW-----LLNGHS-----SIDDSEAELSNNFLILHSV 410
            ..|...|..:|.:.::.|.|.|.....:.|     ::|...     |..:...|:.:...||.:|
Human   792 SYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTV 856

  Fly   411 LKRHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRESGGTHRPKPNQGSRQKQMYPPTPPNVTR 475
             :..:|:..|.|.|..||...  ::|:.   :||                      ||.||.: .
Human   857 -REDSGFFSCHAINSYGEDRG--IIQLT---VQE----------------------PPDPPEI-E 892

  Fly   476 LSD---ESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNW---QTTNDNIPYGKPKWNSELGKSFT 534
            :.|   .::.|||.:..:...||..:.::.:  .|..:|   |.|.|    ..|:.||       
Human   893 IKDVKARTITLRWTMGFDGNSPITGYDIECK--NKSDSWDSAQRTKD----VSPQLNS------- 944

  Fly   535 ASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHW 599
            |::.|:.|..||..|   :|:.|...:|..|.:..:....|....| |:.:.:|..|..::.:.|
Human   945 ATIIDIHPSSTYSIR---MYAKNRIGKSEPSNELTITADEAAPDGP-PQEVHLEPISSQSIRVTW 1005

  Fly   600 SLASDADEHL----ITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETA------------- 647
            ....   :||    |.||...||..|:.|.:           .|.|..::|:             
Human  1006 KAPK---KHLQNGIIRGYQIGYREYSTGGNF-----------QFNIISVDTSGDSEVYTLDNLNK 1056

  Fly   648 -TMYEFKLQSFSAASASEFSALKQGRTQRPKTSTTEE 683
             |.|...:|:.:.|.....|       |...|:|.|:
Human  1057 FTQYGLVVQACNRAGTGPSS-------QEIITTTLED 1086

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 22/88 (25%)
Ig strand B 278..282 CDD:409353 1/3 (33%)
Ig strand C 291..295 CDD:409353 2/3 (67%)
Ig strand E 313..317 CDD:409353 1/4 (25%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 20/94 (21%)
Ig strand B 369..373 CDD:409353 0/3 (0%)
Ig strand C 382..386 CDD:409353 1/8 (13%)
Ig strand E 404..407 CDD:409353 0/2 (0%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
FN3 467..565 CDD:238020 27/103 (26%)
FN3 582..>655 CDD:238020 18/90 (20%)
DSCAMNP_001380.2 FN3 885..978 CDD:238020 28/109 (26%)
FN3 <937..1300 CDD:442628 41/186 (22%)
Ig_3 1287..1363 CDD:464046
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Ig 26..121 CDD:472250
Ig strand B 42..46 CDD:409353
Ig strand C 55..59 CDD:409353
Ig strand E 79..83 CDD:409353
Ig strand F 99..104 CDD:409353
Ig strand G 112..116 CDD:409353
Ig 125..210 CDD:472250
Ig strand B 141..145 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 192..199 CDD:409353
I-set 235..310 CDD:400151
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:472250
Ig strand B 331..335 CDD:409353
Ig strand C 344..348 CDD:409353
Ig strand E 368..372 CDD:409353
Ig strand F 382..387 CDD:409353
Ig 406..501 CDD:472250
Ig strand B 424..428 CDD:409353
Ig strand C 437..441 CDD:409353
Ig strand E 467..471 CDD:409353
Ig strand F 481..486 CDD:409353
Ig strand G 494..497 CDD:409353
IgI_5_Dscam 504..593 CDD:409550 21/103 (20%)
Ig strand A 505..507 CDD:409550 0/1 (0%)
Ig strand A' 512..516 CDD:409550 0/3 (0%)
Ig strand B 519..526 CDD:409550 0/6 (0%)
Ig strand C 533..539 CDD:409550 1/5 (20%)
Ig strand C' 540..542 CDD:409550 0/1 (0%)
Ig strand D 549..553 CDD:409550 0/3 (0%)
Ig strand E 557..563 CDD:409550 3/5 (60%)
Ig strand F 571..579 CDD:409550 4/7 (57%)
Ig strand G 583..593 CDD:409550 2/9 (22%)
Ig 596..686 CDD:472250 24/98 (24%)
Ig strand B 613..617 CDD:409353 1/3 (33%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 1/3 (33%)
Ig strand F 666..671 CDD:409353 2/4 (50%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 25/106 (24%)
putative Ig strand A 689..693 CDD:409397 1/13 (8%)
putative Ig strand A' 698..702 CDD:409397 1/3 (33%)
putative Ig strand B 704..714 CDD:409397 3/9 (33%)
putative Ig strand C 720..726 CDD:409397 3/5 (60%)
putative Ig strand C' 733..736 CDD:409397 0/2 (0%)
putative Ig strand D 744..747 CDD:409397 1/2 (50%)
putative Ig strand E 749..755 CDD:409397 2/5 (40%)
putative Ig strand F 762..770 CDD:409397 3/7 (43%)
putative Ig strand G 775..784 CDD:409397 0/8 (0%)
Ig_DSCAM 785..884 CDD:409398 22/104 (21%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 1/3 (33%)
putative Ig strand B 803..810 CDD:409398 0/6 (0%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 0/2 (0%)
putative Ig strand D 842..846 CDD:409398 0/3 (0%)
putative Ig strand E 848..854 CDD:409398 1/5 (20%)
putative Ig strand F 861..869 CDD:409398 3/7 (43%)
putative Ig strand G 872..882 CDD:409398 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.