DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and PXDNL

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_653252.4 Gene:PXDNL / 137902 HGNCID:26359 Length:1463 Species:Homo sapiens


Alignment Length:667 Identity:142/667 - (21%)
Similarity:235/667 - (35%) Gaps:159/667 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SPGVRILRAPESLVAPLGDEVVLECETSLQPE-RFEWSHRSSRSPGAGFKYLKTGTAKANVSQEA 113
            ||  ||...|:.:..|.|:.|...|.....|: ...|.|.:....      |:..| :.||..:.
Human   233 SP--RITFEPQDVEVPSGNTVYFTCRAEGNPKPEIIWIHNNHSLD------LEDDT-RLNVFDDG 288

  Fly   114 AISRLRVLVRPDTLGEYRCV--GWFGPLVVTSTIAR---LELASTSLVDAQESESPLQWRVSAGN 173
            .:....  .|....|.|:|:  ...|.....|.:.|   |....:.::..|::|      |..|.
Human   289 TLMIRN--TRESDQGVYQCMARNSAGEAKTQSAMLRYSSLPAKPSFVIQPQDTE------VLIGT 345

  Fly   174 SVLWSCGQQVQSNPSASWSYYRNGVEIK-PEFIGTNGNLFLSNVSSESSGSYSCQATNPASGERI 237
            |....|......:|..:|: ..||:|:. ...:.|:..|:|.|::....|.::|.|.|  |...:
Human   346 STTLECMATGHPHPLITWT-RDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANN--SHGTV 407

  Fly   238 QLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSSPDVVGA 302
            |...::.:|..|:          ....|..|  .:.|..::..||...|:|||.:||:.......
Human   408 QAAANIIVQAPPQ----------FTVTPKDQ--VVLEEHAVEWLCEADGNPPPVIVWTKTGGQLP 460

  Fly   303 VKNKRSKVFGHALEISNTRVNDAGTYIC--FQDNGVRPALEHYIKVHVE------------QPPQ 353
            |:.:.:.:....|.|.....:|.|.|.|  ....||:       ||.|:            |.||
Human   461 VEGQHTVLSSGTLRIDRAAQHDQGQYECQAVSSLGVK-------KVSVQLTVKPKALAVFTQLPQ 518

  Fly   354 IVRPPWADLTNE-GDRLKLECKATGVPTPEIYW-------LLNGHSSIDDSEAELSNNFLILHSV 410
                   |.:.| |..:.:.|.|.|.|.|.|.|       ..:|...:||      ...|.::..
Human   519 -------DTSVEVGKNINISCHAQGEPQPIITWNKEGVQITESGKFHVDD------EGTLTIYDA 570

  Fly   411 LKRHAGYVQCFARNRLGEHSAGTLLQVNPKQIQEPRESG----------GTHRPKPNQGSRQKQM 465
            .....|..:|.|||..|.......|.|...|   .|::|          ...|......|.::.:
Human   571 GFPDQGRYECVARNSFGLAVTNMFLTVTAIQ---GRQAGDDFVESSILDAVQRVDSAINSTRRHL 632

  Fly   466 YPPTPPNVTRLSDESVMLRWMVPRNDGLPIV--------IFKVQYRMVGKRKNWQTTNDNIPYGK 522
            :...|.     :...::.::..||:   |::        ||:...:::.:|.....|.|  ..||
Human   633 FSQKPH-----TSSDLLAQFHYPRD---PLIVEMARAGEIFEHTLQLIRERVKQGLTVD--LEGK 687

  Fly   523 P-KWNSELGKSFTASVTDL------KPQHTYRFRIL-AVYSNNDNKESN----------TSAKFY 569
            . ::|..:.....:.:.:|      :|......|.. |.|..:|...:|          |:....
Human   688 EFRYNDLVSPRSLSLIANLSGCTARRPLPNCSNRCFHAKYRAHDGTCNNLQQPTWGAALTAFARL 752

  Fly   570 LQP----------GAAL-----DPMPVPELLE---------IEEYSETAVVLHWS--LASDADE- 607
            |||          |..|     .|:|.|.|:.         ..::|.|.:::||.  |..|.|. 
Human   753 LQPAYRDGIRAPRGLGLPVGSRQPLPPPRLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHT 817

  Fly   608 --HLITGYYAYYRPSSS 622
              .|.|..::..||.||
Human   818 VPALSTARFSDGRPCSS 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 21/83 (25%)
Ig strand B 278..282 CDD:409353 0/3 (0%)
Ig strand C 291..295 CDD:409353 1/3 (33%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/6 (33%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 23/92 (25%)
Ig strand B 369..373 CDD:409353 0/3 (0%)
Ig strand C 382..386 CDD:409353 2/10 (20%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
FN3 467..565 CDD:238020 19/123 (15%)
FN3 582..>655 CDD:238020 15/55 (27%)
PXDNLNP_653252.4 LRR <36..>194 CDD:443914
LRR 1 51..72
leucine-rich repeat 52..85 CDD:275378
LRR 2 75..96
leucine-rich repeat 86..123 CDD:275378
LRR 3 99..120
LRR_8 123..182 CDD:404697
LRR 4 123..144
leucine-rich repeat 124..147 CDD:275378
LRR 5 147..168
leucine-rich repeat 148..171 CDD:275378
leucine-rich repeat 172..184 CDD:275378
LRRCT 180..232 CDD:214507
Ig_3 234..309 CDD:464046 19/85 (22%)
Ig_3 329..402 CDD:464046 18/79 (23%)
Ig 432..505 CDD:472250 21/79 (27%)
Ig strand B 436..440 CDD:409353 0/3 (0%)
Ig strand C 449..453 CDD:409353 1/3 (33%)
Ig strand E 471..475 CDD:409353 1/3 (33%)
Ig strand F 485..490 CDD:409353 2/4 (50%)
Ig strand G 499..502 CDD:409353 1/2 (50%)
Ig 528..596 CDD:472250 17/73 (23%)
Ig strand B 528..532 CDD:409353 0/3 (0%)
Ig strand C 541..545 CDD:409353 1/3 (33%)
Ig strand E 563..567 CDD:409353 1/3 (33%)
Ig strand F 577..582 CDD:409353 1/4 (25%)
Ig strand G 591..594 CDD:409353 0/2 (0%)
peroxidasin_like 851..1286 CDD:188658
VWC 1400..1450 CDD:214564
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.