DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ihog and Cntn5

DIOPT Version :10

Sequence 1:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_446198.1 Gene:Cntn5 / 114589 RGDID:621302 Length:1099 Species:Rattus norvegicus


Alignment Length:808 Identity:179/808 - (22%)
Similarity:287/808 - (35%) Gaps:237/808 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AIPVLEKSPAHPAHSAHPAHPAHPAHPAHPSP-----------GVRILRAPESLVAPL-GDE--V 70
            ::..|..||.....:|...|  .|.:..| ||           |...::.|:.::.|. .||  |
  Rat    58 SLGTLSVSPPSWRGAAQQYH--SPVNLYH-SPDAFRQDESVDYGPVFVQEPDDIIFPTDSDEKKV 119

  Fly    71 VLECETSLQPERFEWSHRSSRSPGAGFKYLKTGTAKANVSQEAAISRLR---VLVRPD---TLGE 129
            .|.||.           |.:.||  .:::|:.|| :.::..:...|.:.   ::..|.   ..|.
  Rat   120 ALNCEV-----------RGNPSP--TYRWLRNGT-EIDLESDYRYSMIDGTFIINNPSESRDSGL 170

  Fly   130 YRCV--GWFGPLVVTSTIARLELA--------STSLVDAQESESPLQWRVSAGNSVLWSCGQQVQ 184
            |:|:  ..||.::  |..|.|:.|        :.|.|..:|           |..|:..|.....
  Rat   171 YQCLATNTFGSIL--SREATLQFAYLGNFSGRTRSAVSVRE-----------GQGVVLMCSPPPH 222

  Fly   185 SNPSASWSYYRNGVEIKPEFIGTN---------GNLFLSNVSSESSGSYSCQATNPASGERIQLP 240
            | |...:|:..|..   |.|:..:         |||::|.|.:...|||.|...|..:..|:..|
  Rat   223 S-PEIIYSWVFNEF---PSFVAEDSRRFISQETGNLYISKVQTSDVGSYICLVKNAVTNARVLSP 283

  Fly   241 GSLQLQVTPEQRSESKSPHLLRG-------QPSSQ-----EITIREGSSLLLLCPGVGSPPPTVV 293
                           .:|..||.       :|..:     .:|..:|:::.:.|..:|:|.||:.
  Rat   284 ---------------PTPLTLRNDGVMGEYEPKIEVHFPTTVTAAKGTTVKMECFALGNPVPTIT 333

  Fly   294 WSSPDVVGAVKNK-RSKVFGHALEISNTRVNDAGTYICFQD-----NGVRPALEHYIKVHVEQPP 352
            |..  |.|.:.:| |.:.....|||.|.:::|||.|.|..:     |..|..|:.|         
  Rat   334 WMK--VNGYIPSKSRLRKSQAVLEIPNLQLDDAGIYECTAENSRGKNSFRGQLQIY--------- 387

  Fly   353 QIVRPPWADLTNE-----GDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLILHSVLK 412
              ..|.|....|:     |..|:.||||||.|.|...||.||...:..|..:.:|..|.:|||.:
  Rat   388 --TYPHWVQKLNDTQLDSGSPLQWECKATGKPRPTYRWLKNGAPLLPQSRVDTANGVLAIHSVNQ 450

  Fly   413 RHAGYVQCFARNRLGEHSAGTLLQV--NPKQIQ------------------EPRESGGTHRPKPN 457
            ..||..||.|.|:.|...|...|::  :|...:                  |.:..|.   |||.
  Rat   451 SDAGMYQCLAENKYGAIYASAELKILASPPSFELNQVKKSIIVTKDREVLIECKPQGS---PKPA 512

  Fly   458 ----------QGSRQKQMYP--------------------------------------PT----P 470
                      :|:::..:.|                                      ||    .
  Rat   513 ISWRKGDKAVRGNKRIAILPDGSLRILNASKADEGKYICQGVNIFGSAEIIASVSVKEPTRIELT 577

  Fly   471 PNVTRLS-DESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFT 534
            |..|.|: .||::|......:..|.:..:            |......|.:.|...:.|..:: .
  Rat   578 PKRTELTVGESIVLNCKAMHDSSLDVTFY------------WTLKGQPIDFEKEGGHFESIRA-Q 629

  Fly   535 ASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAAL--DPMPVPELLEIEEYSETAVVL 597
            ||..||..::     ||.:::........|:|.........|  .|...|.::.:||.:|:...|
  Rat   630 ASSADLMIRN-----ILLMHAGRYGCRVQTTADSVSDEAELLVRGPPGPPGVVIVEEITESTATL 689

  Fly   598 HWSLASDADEHLITGYYAYYRPSSSAG--------EYFKATIEGAHARSFKIAPLETATMYEFKL 654
            .||.|:| :...|:.|....|...|.|        |.....:|.|.|     ..|.....|||::
  Rat   690 SWSPATD-NHSPISSYNLQARSPFSLGWQTVKTVPEVITGDMESAMA-----VDLNPWVEYEFRV 748

  Fly   655 QSFSAASASEFS-ALKQGRTQR--PKTS 679
            .:.:.....:.| ..:..||..  |||:
  Rat   749 VATNPIGTGDPSIPSRMIRTNEAVPKTA 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ihogNP_609085.1 Ig 266..348 CDD:472250 25/92 (27%)
Ig strand B 278..282 CDD:409353 0/3 (0%)
Ig strand C 291..295 CDD:409353 1/3 (33%)
Ig strand E 313..317 CDD:409353 1/3 (33%)
Ig strand F 327..332 CDD:409353 2/4 (50%)
Ig strand G 341..344 CDD:409353 0/2 (0%)
Ig 352..437 CDD:472250 32/89 (36%)
Ig strand B 369..373 CDD:409353 1/3 (33%)
Ig strand C 382..386 CDD:409353 0/3 (0%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 2/4 (50%)
Ig strand G 430..433 CDD:409353 1/2 (50%)
FN3 467..565 CDD:238020 20/140 (14%)
FN3 582..>655 CDD:238020 22/80 (28%)
Cntn5NP_446198.1 Ig 98..193 CDD:472250 25/110 (23%)
Ig strand B 119..123 CDD:409353 2/3 (67%)
Ig strand C 132..136 CDD:409353 0/3 (0%)
Ig strand E 155..159 CDD:409353 0/3 (0%)
Ig strand F 170..175 CDD:409353 2/4 (50%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 202..287 CDD:472250 24/114 (21%)
Ig strand B 213..217 CDD:409353 1/3 (33%)
Ig strand C 227..231 CDD:409353 1/3 (33%)
Ig strand E 252..256 CDD:409353 3/3 (100%)
Ig strand F 266..271 CDD:409353 3/4 (75%)
Ig strand G 282..285 CDD:409353 1/17 (6%)
Ig 300..387 CDD:472250 25/88 (28%)
Ig strand B 318..322 CDD:409353 0/3 (0%)
Ig strand C 331..335 CDD:409353 1/3 (33%)
Ig strand E 352..356 CDD:409353 1/3 (33%)
Ig strand F 366..371 CDD:409353 2/4 (50%)
Ig strand G 379..382 CDD:409353 0/2 (0%)
Ig 392..475 CDD:472250 31/82 (38%)
Ig strand B 407..411 CDD:143205 1/3 (33%)
Ig strand C 420..424 CDD:143205 0/3 (0%)
Ig strand E 441..445 CDD:143205 1/3 (33%)
Ig strand F 455..460 CDD:143205 2/4 (50%)
Ig strand G 468..471 CDD:143205 1/2 (50%)
Ig5_Contactin 480..568 CDD:409358 7/90 (8%)
Ig strand A 480..485 CDD:409358 0/4 (0%)
Ig strand A' 488..493 CDD:409358 0/4 (0%)
Ig strand B 497..504 CDD:409358 1/6 (17%)
Ig strand C 512..516 CDD:409358 0/3 (0%)
Ig strand D 530..533 CDD:409358 0/2 (0%)
Ig strand E 534..539 CDD:409358 0/4 (0%)
Ig strand F 547..555 CDD:409358 0/7 (0%)
Ig strand G 561..568 CDD:409358 0/6 (0%)
Ig 570..671 CDD:472250 22/118 (19%)
Ig strand B 589..593 CDD:409353 1/3 (33%)
Ig strand C 604..608 CDD:409353 0/15 (0%)
Ig strand E 633..637 CDD:409353 2/3 (67%)
Ig strand F 647..652 CDD:409353 0/4 (0%)
Ig strand G 660..663 CDD:409353 0/2 (0%)
FN3 667..>1060 CDD:442628 29/116 (25%)
FN3 671..768 CDD:238020 23/102 (23%)
FN3 878..969 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 958..983
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.