DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and GR-RBP5

DIOPT Version :9

Sequence 1:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_177563.1 Gene:GR-RBP5 / 843763 AraportID:AT1G74230 Length:289 Species:Arabidopsis thaliana


Alignment Length:301 Identity:78/301 - (25%)
Similarity:116/301 - (38%) Gaps:84/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYI-- 159
            |:|:||:..:..|..||..|::||:|.:..|:.|:|..:||||.|::|   :|.|..:|...:  
plant    35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTF---TSTEEASNAMQLDG 96

  Fly   160 -NLNGKQVEIKKAEPR-DGSGGQNSNNSTVGGAYGKLGNECSHWGPHHAPINMMQGQNGQMGGPP 222
             :|:|:::.:..|..| .|.||:.....  ||.||                    ..:|..|.| 
plant    97 QDLHGRRIRVNYATERGSGFGGRGFGGP--GGGYG--------------------ASDGGYGAP- 138

  Fly   223 LNMPIGAPNMMPGYQGWGTSPQQQQYGYGNSGPGSYQGWGAPPGPQGPPPQWSNYAGPQQTQGYG 287
                       .|..|.|..      |||  |..||.|.....|..|....:...||     |||
plant   139 -----------AGGYGGGAG------GYG--GNSSYSGNAGGGGGYGGNSSYGGNAG-----GYG 179

  Fly   288 GYDMYNSTSTGAPSGPSGGGSWNSWNMPPNSAGPTGAPGAGAGTATDMYSRAQAWATGGPSTTG- 351
            |...|:..:.|      |||.:.|     |..|     |.|.|.|..: ..::.:|.|..:..| 
plant   180 GNPPYSGNAVG------GGGGYGS-----NFGG-----GGGYGVAGGV-GGSENFAQGSSTNAGF 227

  Fly   352 --------PVGG----MPRTGPGNSASKSGSEYDYGGYGSG 380
                    |:|.    ...:|.|......||:..:|...:|
plant   228 DDKFESNQPLGNDTDHQTESGLGGDEQFGGSDNQFGDAENG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018
RRM2_DAZAP1 94..173 CDD:240773 26/78 (33%)
GR-RBP5NP_177563.1 RRM_SF 35..109 CDD:302621 25/76 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.