DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and AT5G53720

DIOPT Version :9

Sequence 1:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_200183.1 Gene:AT5G53720 / 835453 AraportID:AT5G53720 Length:100 Species:Arabidopsis thaliana


Alignment Length:77 Identity:33/77 - (42%)
Similarity:47/77 - (61%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNG 68
            |...|::|.||.|.|..|.|..||.|||:|:...|:.:..:.||:|||||||.:..:.....:|.
plant     6 DRETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENP 70

  Fly    69 PHTLDGRTIDPK 80
            .||:||||::.|
plant    71 NHTIDGRTVNCK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 32/73 (44%)
RRM2_DAZAP1 94..173 CDD:240773
AT5G53720NP_200183.1 RRM_SF 9..84 CDD:418427 32/74 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.