DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and AT5G53720

DIOPT Version :10

Sequence 1:NP_476869.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_200183.1 Gene:AT5G53720 / 835453 AraportID:AT5G53720 Length:100 Species:Arabidopsis thaliana


Alignment Length:77 Identity:33/77 - (42%)
Similarity:47/77 - (61%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNG 68
            |...|::|.||.|.|..|.|..||.|||:|:...|:.:..:.||:|||||||.:..:.....:|.
plant     6 DRETKIYVAGLPWITRTEGLISYFERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENP 70

  Fly    69 PHTLDGRTIDPK 80
            .||:||||::.|
plant    71 NHTIDGRTVNCK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_476869.1 RRM1_hnRNPA_hnRNPD_like 9..80 CDD:409763 30/70 (43%)
RRM2_DAZAP1 94..173 CDD:409765
AT5G53720NP_200183.1 RRM_SF 9..84 CDD:473069 32/74 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.