DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and CG2931

DIOPT Version :9

Sequence 1:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:82 Identity:24/82 - (29%)
Similarity:44/82 - (53%) Gaps:4/82 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNG 68
            |:..::|.|.|..:...|.|:|.|.:|.......|:::..:|:|:|||||:|.:|.:....::. 
  Fly   195 DDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKE- 258

  Fly    69 PHTLDGRTIDPKPCNPR 85
               :|||.:..:|...|
  Fly   259 ---MDGRYVGSRPIKLR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 23/78 (29%)
RRM2_DAZAP1 94..173 CDD:240773
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 24/82 (29%)
RRM <194..>280 CDD:223796 24/82 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464032
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.