DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and SLIRP1

DIOPT Version :9

Sequence 1:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:76 Identity:24/76 - (31%)
Similarity:47/76 - (61%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYIN 160
            :::|:|.||..|...:||.:|..:|:|....:::|:....|:|:||:||...:::|.:.||:...
  Fly    15 HRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENEQKHI 79

  Fly   161 LNGKQVEIKKA 171
            |.|..:.|:|:
  Fly    80 LEGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018
RRM2_DAZAP1 94..173 CDD:240773 24/76 (32%)
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.