DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and hrpa-2

DIOPT Version :9

Sequence 1:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:237 Identity:65/237 - (27%)
Similarity:107/237 - (45%) Gaps:47/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTL 72
            |||:||||.:||.|.|..||.::|.::|.:|:::..:..||||||||||...:....:.:.||.|
 Worm    71 KLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPHKL 135

  Fly    73 DGRTIDPKPCNPRTLQ---------KPKKGGGYKVFLGGLPSNVTETD-LRTFFNRYGKVTEVVI 127
            .|:|:|.|...||...         :.....|.|:.|.|:.:.|...| ||.:|..:|.:.:|.|
 Worm   136 GGKTVDSKRAIPREQMSSMIPPPFFETDPAPGCKLLLNGITNGVHSVDSLRVYFETFGTLDQVEI 200

  Fly   128 MYDQEKKKSRGFGFLSFEEESSVE---------HVTNERYINL-------NGKQV---------- 166
            :     .:.||.||:.:|::.|.:         |:.|||.|.:       ||...          
 Worm   201 L-----GQPRGLGFVIYEDKESADRCLAHNSGRHIVNERKIEVRVFTKHPNGSTYWKRPQSQSHS 260

  Fly   167 ------EIKKAEPRDGSGGQNSNNSTVGGAYGKLGNECSHWG 202
                  ::.:...:||......|:|:..........:.::.|
 Worm   261 QRDLFEQLSQLNLKDGDRKSTGNSSSAADTPQNFDEDSNYGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 35/89 (39%)
RRM2_DAZAP1 94..173 CDD:240773 25/111 (23%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 53/163 (33%)
RRM1_hnRNPA_like 71..148 CDD:241022 33/76 (43%)
RRM_SF 183..240 CDD:302621 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1565323at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.