DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb27C and rsp-1

DIOPT Version :9

Sequence 1:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_496442.1 Gene:rsp-1 / 174748 WormBaseID:WBGene00004698 Length:312 Species:Caenorhabditis elegans


Alignment Length:193 Identity:44/193 - (22%)
Similarity:72/193 - (37%) Gaps:73/193 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINL 161
            ::::|.|.|.|:|.|:..||..||::.:|::        ..||||:.|:::...|...::    |
 Worm     4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLL--------KNGFGFVEFDDKRDAEDAVHD----L 56

  Fly   162 NGKQ-----VEIKKAEPRDGSGGQNSNNSTVGGAYGKLGNECSHWGPHHAPINMMQGQNGQMGGP 221
            |||:     |.:..::||.|.|.:        |.:|                      .|..||.
 Worm    57 NGKELGGERVILDYSKPRGGGGDR--------GGFG----------------------GGGRGGA 91

  Fly   222 PLNMPIGAPNMMPGYQGWGTSPQQQQYGYGNSGPGSYQGWGAPPGPQGPPPQWSNYAGPQQTQ 284
            .::          .|.|.|        |.|......|.        :|||.:.|.|..|..|:
 Worm    92 RVS----------SYSGGG--------GGGRDRFDRYD--------RGPPRRESRYGRPYSTR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018
RRM2_DAZAP1 94..173 CDD:240773 22/80 (28%)
rsp-1NP_496442.1 RRM <3..180 CDD:223796 44/193 (23%)
RRM1_SRSF4_like 4..73 CDD:240783 22/80 (28%)
RRM2_SRSF4_like 129..200 CDD:241044 44/193 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.