DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SRSF9

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens


Alignment Length:206 Identity:65/206 - (31%)
Similarity:89/206 - (43%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPG---FAFVEFESARDAADAVRGLDGRT 68
            |.::|||:|..:.|:.|||.:|..||.:|.:.: :|..|   ||||.||..|||.||:.|.:|..
Human    13 DGRIYVGNLPTDVREKDLEDLFYKYGRIREIEL-KNRHGLVPFAFVRFEDPRDAEDAIYGRNGYD 76

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGGG----------LGGRDRGGGGR--------GDD 115
            ....|.|||     :.|:.||.||...||..|.          :.|....|..:        ..|
Human    77 YGQCRLRVE-----FPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGD 136

  Fly   116 KCY---ECGGRG-----------HFARHCRERKARQRRRSNSFSR---SRSTSRRRRTRSKSGTR 163
            .||   :..|.|           :..|...:.|.|......|:.|   .|||| ...:||:||:|
Human   137 VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTS-YGYSRSRSGSR 200

  Fly   164 SRS---RSAGS 171
            .|.   :|.||
Human   201 GRDSPYQSRGS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 32/77 (42%)
RRM_SRSF3_like 9..81 CDD:240819 31/74 (42%)
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 31/76 (41%)
RRM2_SRSF9 104..186 CDD:410161 12/81 (15%)
Interaction with SAFB1 188..200 6/12 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.