Sequence 1: | NP_723226.1 | Gene: | x16 / 33967 | FlyBaseID: | FBgn0028554 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003760.1 | Gene: | SRSF9 / 8683 | HGNCID: | 10791 | Length: | 221 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 65/206 - (31%) |
---|---|---|---|
Similarity: | 89/206 - (43%) | Gaps: | 48/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 DRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPG---FAFVEFESARDAADAVRGLDGRT 68
Fly 69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGGG----------LGGRDRGGGGR--------GDD 115
Fly 116 KCY---ECGGRG-----------HFARHCRERKARQRRRSNSFSR---SRSTSRRRRTRSKSGTR 163
Fly 164 SRS---RSAGS 171 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
x16 | NP_723226.1 | RRM | <1..>82 | CDD:223796 | 32/77 (42%) |
RRM_SRSF3_like | 9..81 | CDD:240819 | 31/74 (42%) | ||
SRSF9 | NP_003760.1 | RRM1_SRSF9 | 15..86 | CDD:241042 | 31/76 (41%) |
RRM2_SRSF9 | 104..186 | CDD:410161 | 12/81 (15%) | ||
Interaction with SAFB1 | 188..200 | 6/12 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 189..221 | 10/24 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |