DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and HRB1

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_014394.2 Gene:HRB1 / 855728 SGDID:S000004949 Length:454 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:49/167 - (29%)
Similarity:59/167 - (35%) Gaps:51/167 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGR------------- 182
            :||.:....||.  |||||..|||.:......|....|     ||||..|||             
Yeast     4 QERGSENNNRSR--SRSRSPVRRRMSDDHGYERDNHLS-----RRSGNYNGRRKFADTYRGSRDR 61

  Fly   183 -DENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGS-------------PRS-RSRSRS 232
             :..|...|....||......|:|     |..|..|||.||.             ||| |||..:
Yeast    62 GEYRGGRERSDYRERERFNNRDNP-----RSRDRYDDRRRGRDVTGRYGNRRDDYPRSFRSRHNT 121

  Fly   233 ASPAVRRG---SPPR--------RRGDSSASRSVSRD 258
            ...:.|.|   |..|        |..||:....|:|:
Yeast   122 RDDSRRGGFGSSGARGDYGPLLARELDSTYEEKVNRN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808
HRB1NP_014394.2 PRK12678 <29..>85 CDD:237171 14/60 (23%)
RRM1_HRB1_GBP2 160..236 CDD:410184
RRM2_HRB1_GBP2 262..334 CDD:410185
RRM3_HRB1_GBP2 374..452 CDD:410186
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.