DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and PUB1

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:71 Identity:22/71 - (30%)
Similarity:39/71 - (54%) Gaps:4/71 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRS--VWIARNPP--GFAFVEFESARDAADAVRG 63
            |..|||.:|||:|.....::.|:..|...|.:.:  :.|.:|..  .:||||:..:.||..|::.
Yeast    70 RETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQT 134

  Fly    64 LDGRTV 69
            |:|:.:
Yeast   135 LNGKQI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 18/65 (28%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026 18/64 (28%)
RRM2_PUB1 161..240 CDD:410031
RRM3_PUB1 341..414 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.