Sequence 1: | NP_723226.1 | Gene: | x16 / 33967 | FlyBaseID: | FBgn0028554 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010720.3 | Gene: | NPL3 / 852042 | SGDID: | S000002840 | Length: | 414 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 335 | Identity: | 71/335 - (21%) |
---|---|---|---|
Similarity: | 98/335 - (29%) | Gaps: | 152/335 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 SDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVC 70
Fly 71 ------------GRRARVELST------------------------------------------- 80
Fly 81 -----------------------------------------------------GKYARSGGGGGG 92
Fly 93 GGGGGGGGGLGGRDRGG-GGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRSTSRRRRT 156
Fly 157 RSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVR 221
Fly 222 GSPRSRSRSR 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
x16 | NP_723226.1 | RRM | <1..>82 | CDD:223796 | 23/183 (13%) |
RRM_SRSF3_like | 9..81 | CDD:240819 | 22/179 (12%) | ||
NPL3 | NP_010720.3 | PHA03247 | <11..87 | CDD:223021 | |
RBD_RRM1_NPL3 | 126..192 | CDD:409777 | 20/68 (29%) | ||
RRM2_SRSF1_4_like | 200..271 | CDD:409776 | 1/70 (1%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |