DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and NPL3

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_010720.3 Gene:NPL3 / 852042 SGDID:S000002840 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:335 Identity:71/335 - (21%)
Similarity:98/335 - (29%) Gaps:152/335 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVC 70
            |:.:::|.....:.::::|..:||.:|.::.|.|..   ||||||||.|..||.|:..:.|::..
Yeast   123 SNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN---GFAFVEFEEAESAAKAIEEVHGKSFA 184

  Fly    71 ------------GRRARVELST------------------------------------------- 80
                        .:|.|:.:..                                           
Yeast   185 NQPLEVVYSKLPAKRYRITMKNLPEGCSWQDLKDLARENSLETTFSSVNTRDFDGTGALEFPSEE 249

  Fly    81 -----------------------------------------------------GKYARSGGGGGG 92
                                                                 |.::|.|.||..
Yeast   250 ILVEALERLNNIEFRGSVITVERDDNPPPIRRSNRGGFRGRGGFRGGFRGGFRGGFSRGGFGGPR 314

  Fly    93 GGGGGGGGGLGGRDRGG-GGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRSTSRRRRT 156
            ||.||..||.||..||| ||      |..||.|.                   ||....|.|...
Yeast   315 GGFGGPRGGYGGYSRGGYGG------YSRGGYGG-------------------SRGGYDSPRGGY 354

  Fly   157 RSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVR 221
            .|..|..||   .|..|.|:.....|...|.:....|..|...|      ||:..|      |.|
Yeast   355 DSPRGGYSR---GGYGGPRNDYGPPRGSYGGSRGGYDGPRGDYG------PPRDAY------RTR 404

  Fly   222 GSPRSRSRSR 231
            .:||.||.:|
Yeast   405 DAPRERSPTR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 23/183 (13%)
RRM_SRSF3_like 9..81 CDD:240819 22/179 (12%)
NPL3NP_010720.3 PHA03247 <11..87 CDD:223021
RBD_RRM1_NPL3 126..192 CDD:409777 20/68 (29%)
RRM2_SRSF1_4_like 200..271 CDD:409776 1/70 (1%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.