DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and TIF35

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_010717.1 Gene:TIF35 / 852039 SGDID:S000002837 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:74 Identity:26/74 - (35%)
Similarity:33/74 - (44%) Gaps:6/74 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGNNARKNDL-EYVFGAYGSLRSVWIARNPP-----GFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :..||.:|.| |.:...:..:..|.:.||..     |.|||.|.|...|..|:|.||||......
Yeast   198 VNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLI 262

  Fly    74 ARVELSTGK 82
            .|||.|..|
Yeast   263 LRVEWSKPK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 25/71 (35%)
TIF35NP_010717.1 eIF3g 6..127 CDD:463545
RRM_eIF3G_like 192..268 CDD:409842 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.