DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RNP1

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_013054.1 Gene:RNP1 / 850680 SGDID:S000003969 Length:249 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:21/76 - (27%)
Similarity:35/76 - (46%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGA-YGSLRSVWIARNP-----PGFAFVEFESARDAADAVRGLDG 66
            |.:|||:|..|.||.||..:|.. ||.:....:.:.|     ..|||:||:...:.......::|
Yeast    35 RTLYVGNLPKNCRKQDLRDLFEPNYGKITINMLKKKPLKKPLKRFAFIEFQEGVNLKKVKEKMNG 99

  Fly    67 RTVCGRRARVE 77
            :.....:..:|
Yeast   100 KIFMNEKIVIE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 21/76 (28%)
RRM_SRSF3_like 9..81 CDD:240819 20/75 (27%)
RNP1NP_013054.1 RRM <22..224 CDD:223796 21/76 (28%)
RRM 36..109 CDD:214636 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.