DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and AT1G73530

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_177494.1 Gene:AT1G73530 / 843687 AraportID:AT1G73530 Length:181 Species:Arabidopsis thaliana


Alignment Length:89 Identity:25/89 - (28%)
Similarity:44/89 - (49%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSV-----WIARNPPGFAFVEFESARDAADAVRGLDGRT 68
            |:||..|.....::.|...|..:|:|..:     .:|..|.||||:.:|:..:|..|::|:.|:.
plant    78 KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKAIQGMHGKF 142

  Fly    69 VCGR-------RARVELSTGKYAR 85
            :.||       :.|.::|..|..|
plant   143 LDGRVIFVEEAKTRSDMSRAKPRR 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 23/83 (28%)
AT1G73530NP_177494.1 RRM 78..158 CDD:440488 22/79 (28%)

Return to query results.
Submit another query.