DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and UBP1A

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_849806.1 Gene:UBP1A / 841846 AraportID:AT1G54080 Length:430 Species:Arabidopsis thaliana


Alignment Length:80 Identity:23/80 - (28%)
Similarity:36/80 - (45%) Gaps:9/80 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VYVGDLGNNARKNDLEYVFGAYGS-------LRSVWIAR--NPPGFAFVEFESARDAADAVRGLD 65
            ::||||........|...|.|:.|       .|.:|..:  ...||.||.|.:.:||..|:..::
plant   150 IFVGDLSPEVTDAALFDSFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMN 214

  Fly    66 GRTVCGRRARVELST 80
            |:.|..|:.|...:|
plant   215 GKWVSSRQIRCNWAT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 23/80 (29%)
UBP1ANP_849806.1 RRM1_PUB1 65..135 CDD:410026
RRM2_PUB1 147..230 CDD:410031 23/80 (29%)
RRM_SF 273..349 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.