DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RSZ21

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_564208.1 Gene:RSZ21 / 838997 AraportID:AT1G23860 Length:187 Species:Arabidopsis thaliana


Alignment Length:248 Identity:93/248 - (37%)
Similarity:110/248 - (44%) Gaps:71/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :||||:|.....:.:||..|.|:|.||:||:||.|||:||:||:..|||.||:..||.:    ..
plant     3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDRK----NG 63

  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRERKARQR 138
            .|||||   :...||.|||||             ..||..|.||||||..|||||.||..:...|
plant    64 WRVELS---HKDKGGRGGGGG-------------RRGGIEDSKCYECGELGHFARECRRGRGSVR 112

  Fly   139 RRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVD 203
            |||.|       .||||:......|   ||....||||                           
plant   113 RRSPS-------PRRRRSPDYGYAR---RSISPRGRRS--------------------------- 140

  Fly   204 SPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVR--RGSPPRRRGDSSASRS 254
               ||:||         ..:|..|.||.|.||..|  |...||||......||
plant   141 ---PPRRR---------SVTPPRRGRSYSRSPPYRGSRRDSPRRRDSPYGRRS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 35/71 (49%)
RSZ21NP_564208.1 RRM_SRSF3_like 3..70 CDD:409808 35/73 (48%)
zf-CCHC 90..104 CDD:395050 11/13 (85%)

Return to query results.
Submit another query.