DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RBM4B

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:129 Identity:37/129 - (28%)
Similarity:59/129 - (45%) Gaps:25/129 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDG 66
            ::..:..|::||::.......:|...|..||.:....|.::   :|||..|.|.||.:|:||||.
Human    72 NKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKD---YAFVHMERAEDAVEAIRGLDN 133

  Fly    67 RTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC 130
            ....|:|..|:|||.:...:.|.|               |:.|       ||.||..||:::.|
Human   134 TEFQGKRMHVQLSTSRLRTAPGMG---------------DQSG-------CYRCGKEGHWSKEC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 25/71 (35%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 22/68 (32%)
PTZ00368 <145..>181 CDD:173561 14/53 (26%)
ZnF_C2HC 161..176 CDD:197667 8/22 (36%)
Interaction with TNPO3. /evidence=ECO:0000250 196..359
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.