DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and AT4G26650

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_567753.1 Gene:AT4G26650 / 828772 AraportID:AT4G26650 Length:455 Species:Arabidopsis thaliana


Alignment Length:129 Identity:31/129 - (24%)
Similarity:41/129 - (31%) Gaps:54/129 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HLSGAAGADFAQLSDLFLSGNQLTAINLSGFNGMPSLETLDLQNNRIRRVQGTL--ESNTLKTLD 216
            ||    |.|:.||....|..|             |..|..:...::.......|  ||||.|  .
plant    14 HL----GQDYEQLRAQSLPPN-------------PPFEDKEFPASQASLGSNKLGPESNTAK--G 59

  Fly   217 LSW-----------------NRIDVLYCCE------WNLPSLVRLTLSRNELSRLPTCLSLVMP 257
            :.|                 .|.|:   |:      |.|.|:..|||:..       .||||:|
plant    60 IVWLRPSEIHPNPEFITSGATRFDI---CQQDLGDCWILSSMACLTLNEE-------YLSLVVP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808
AT4G26650NP_567753.1 RRM1_hnRNPA_hnRNPD_like 17..87 CDD:409763 17/87 (20%)
RRM2_Hrp1p 123..200 CDD:409767
ser_rich_anae_1 <204..>385 CDD:468206
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.