DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RS40

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001190837.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:352 Identity:93/352 - (26%)
Similarity:120/352 - (34%) Gaps:137/352 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLD----GRT 68
            :.|:.|:...:||:.|||.:|..||.:..|.:   ..|||||..|..|||.||:|.||    ||.
plant     2 KPVFCGNFEYDAREGDLERLFRKYGKVERVDM---KAGFAFVYMEDERDAEDAIRALDRFEFGRK 63

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGG----------------------------------- 98
              |||.|||     :.:|..||....|||.                                   
plant    64 --GRRLRVE-----WTKSERGGDKRSGGGSRRSSSSMRPSKTLFVINFDADNTRTRDLEKHFEPY 121

  Fly    99 GGGLGGR--------------------DRGGGGRGDDKCY---------ECGGRGHFARHCRERK 134
            |..:..|                    |.....:..||..         :..|.||.....|:|.
plant   122 GKIVNVRIRRNFAFIQYEAQEDATRALDASNNSKLMDKVISVEYAVKDDDARGNGHSPERRRDRS 186

  Fly   135 ARQRRRSNS-FSRSRSTS------------RRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENG 186
            ..:||||.| :.|.|.:.            |:.||....| |.||.|.....||.....|||..|
plant   187 PERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDYG-RRRSPSPYKKSRRGSPEYGRDRRG 250

  Fly   187 -----------SASRYS-------------------DHERNGSGAVDSPPPPKRRYEDEDDDRVR 221
                       |.::||                   :..|||.|.|:|  |.:||      :|.|
plant   251 NDSPRRRERVASPTKYSRSPNNKRERMSPNHSPFKKESPRNGVGEVES--PIERR------ERSR 307

  Fly   222 GSPRSRSRSRSASPAVRRGSPPRRRGD 248
            .||.:   .:..||    ||..||..|
plant   308 SSPEN---GQVESP----GSIGRRDSD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 33/77 (43%)
RRM_SRSF3_like 9..81 CDD:240819 33/75 (44%)
RS40NP_001190837.1 RRM1_AtRSp31_like 2..73 CDD:240680 33/80 (41%)
RRM_SF 98..167 CDD:388407 5/68 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.