DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SR34b

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001328194.1 Gene:SR34b / 828027 AraportID:AT4G02430 Length:292 Species:Arabidopsis thaliana


Alignment Length:304 Identity:94/304 - (30%)
Similarity:120/304 - (39%) Gaps:110/304 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SDRKVYVGDLGNNARKNDLEYVFGAYGSLRSV--WIARNPPGFAFVEFESARDAADAVRGLDGRT 68
            |.|.:|||:|..:.|:.::|.:|..||.:..:  .|...|||:||||||.||||.||:.|.||..
plant     5 SSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGYD 69

  Fly    69 VCGRRARVELSTG-----KYARSGGGGGGGGGGGGGGGLGGRDRGGGGR---------------- 112
            ..|...||||:.|     ..||....|.|.||.|||.| |||:||...|                
plant    70 FDGHHLRVELAHGGRRSSHDARGSYSGRGRGGRGGGDG-GGRERGPSRRSEYRVVVSGLPSSASW 133

  Fly   113 ---------GDDKCYE---CGGRG---------------------------HFARHCRE----RK 134
                     |.:.|:.   ..|||                           |.....||    |.
plant   134 QDLKDHMRKGGEVCFSQVFRDGRGTTGIVDYTSYEDMKYALDDTEFRNAFSHEYVRVREYDSRRD 198

  Fly   135 ARQRRRSNSFSRSRSTSR---RRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHER 196
            :|...|..|:|:|||..|   |.|:||:|.::|||..|.|:.|...:|..|              
plant   199 SRSPSRGRSYSKSRSRGRSPSRSRSRSRSRSKSRSPKAKSLRRSPAKSTSR-------------- 249

  Fly   197 NGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRG 240
                                      ||||||||:|.|.:.|.|
plant   250 --------------------------SPRSRSRSKSRSLSPRGG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 36/82 (44%)
RRM_SRSF3_like 9..81 CDD:240819 33/73 (45%)
SR34bNP_001328194.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.