DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and AT4G13860

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_193122.2 Gene:AT4G13860 / 827020 AraportID:AT4G13860 Length:87 Species:Arabidopsis thaliana


Alignment Length:75 Identity:26/75 - (34%)
Similarity:39/75 - (52%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAADAVRGLDGRT 68
            :||||:|......:.|...|..||::....:.|:     ..||.||.:.|..:|..||.|:||:.
plant     4 RVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKE 68

  Fly    69 VCGRRARVEL 78
            :.|||..|:|
plant    69 LNGRRVSVKL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 26/75 (35%)
AT4G13860NP_193122.2 RRM 2..77 CDD:440488 24/72 (33%)

Return to query results.
Submit another query.