DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and AT4G12640

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_193001.2 Gene:AT4G12640 / 826877 AraportID:AT4G12640 Length:823 Species:Arabidopsis thaliana


Alignment Length:343 Identity:72/343 - (20%)
Similarity:106/343 - (30%) Gaps:136/343 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPG--FAFVEFESARDAADAVRGLD 65
            |:|..|.::||:|.:...:.:|...|..:|.|.|:..   .||  :|||.|....||..|:..|.
plant    18 RNPPSRHLWVGNLPHGILERELADRFLRFGELESLAF---QPGRSYAFVNFNHDEDAFAAIESLQ 79

  Fly    66 GRTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC 130
            |..:.|...|:|.:..:.:.:                       |.|.||          ..||.
plant    80 GFPLSGNPLRIEFAKAEKSST-----------------------GSRTDD----------IYRHD 111

  Fly   131 RERKA-----------RQRRRS-NSFSRSRSTSRR----------------------RRTRSKSG 161
            .:|.|           |.|..| :::|:|:...|.                      |...|..|
plant   112 EQRSAARGSSFVQRDSRMRYESPDTYSKSKMNDRNAEPSEVLYIGFPASLKVDDALLRNVFSSFG 176

  Fly   162 ---------------------------------------------TRSRSRSAGSVGRRSGRS-- 179
                                                         .:|...|:||....||||  
plant   177 EITKVTVFPGRSYAFVQFRNLMAACKAKESLQGKLFGNPRVHICFAKSEPSSSGSGRGPSGRSLS 241

  Fly   180 ---NGRDENGSASRYSDHERNGSGAVDSPPPPKRRY--EDEDDDRVRGSPRSRSRSRSASPAVRR 239
               ...|..||:..|. .:|| .|::...|..:..:  ||.|.:...|...:|.|..|:.     
plant   242 PPYRSVDRLGSSEGYL-QDRN-YGSISRIPSVREPHYIEDRDLEDSEGYIFNRKRDSSSD----- 299

  Fly   240 GSPPRRRGDSSASRSVSR 257
            |.|...|     |||..|
plant   300 GGPAYGR-----SRSTHR 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 25/80 (31%)
RRM_SRSF3_like 9..81 CDD:240819 22/73 (30%)
AT4G12640NP_193001.2 RRM3_Spen 25..94 CDD:240756 22/71 (31%)
RRM_SF 153..223 CDD:302621 3/69 (4%)
SPOC 471..567 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.