DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RS31

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:289 Identity:78/289 - (26%)
Similarity:106/289 - (36%) Gaps:80/289 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGR 72
            |.|:||:.....|::|||.:|..||.:..|.:   ..|:|||.||..|||.||:|.||.......
plant     2 RPVFVGNFEYETRQSDLERLFDKYGRVDRVDM---KSGYAFVYFEDERDAEDAIRKLDNFPFGYE 63

  Fly    73 RARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDD---------------KCYECGG 122
            :.|:.:...|                  |..||.||......:               :..|...
plant    64 KRRLSVEWAK------------------GERGRPRGDAKAPSNLKPTKTLFVINFDPIRTKEHDI 110

  Fly   123 RGHFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSV----------GRRSG 177
            ..||..:.:....|.||   :||..:..::...|::...|: ||:....|          ..|..
plant   111 EKHFEPYGKVTNVRIRR---NFSFVQFETQEDATKALEATQ-RSKILDRVVSVEYALKDDDERDD 171

  Fly   178 RSNGRDENGSAS-----RYS-DHERNGS-GAVDSPPPPKRRYEDEDDDRVRG--------SP--- 224
            |:.||....|.|     |.| |:.|..| |....|.|...|....:.||.:|        ||   
plant   172 RNGGRSPRRSLSPVYRRRPSPDYGRRPSPGQGRRPSPDYGRARSPEYDRYKGPAAYERRRSPDYG 236

  Fly   225 -------RSRS----RSRSASPAVRRGSP 242
                   |.||    |.||.|| |.||.|
plant   237 RRSSDYGRQRSPGYDRYRSRSP-VPRGRP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 27/73 (37%)
RRM_SRSF3_like 9..81 CDD:240819 26/71 (37%)
RS31NP_567120.1 RRM_SF 2..73 CDD:418427 27/73 (37%)
RRM2_AtRSp31_like 94..163 CDD:409899 13/72 (18%)
PTZ00449 <138..209 CDD:185628 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.