DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and PHIP1

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:211 Identity:46/211 - (21%)
Similarity:78/211 - (36%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNP-----PGFAFVEFESARDAADAVRGLDGRT 68
            :||:|:|..:..:.|:..:|... .:.||.:.:|.     .|:|.|:|:.:...|.|:: ||.:.
plant   263 RVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGEFKGYAHVDFKDSVSVAIALK-LDQQV 325

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGG------------GLGGRDRGGGGR------GDD 115
            :|||..::..:......:....|.....|...            .|.||.....|.      ...
plant   326 ICGRPVKICCALKDRPATDHTPGETNNAGSYNMEDTYAAADPVPALAGRSEVDDGNYFATTVSSS 390

  Fly   116 K-----CYECGGRGHFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRR 175
            |     |||||.:||.:..|..:..:...::|               ||.|..:..      ||.
plant   391 KVKRRVCYECGEKGHLSTACPIKLQKADDQAN---------------SKLGQETVD------GRP 434

  Fly   176 SGRSNGRDENGSASRY 191
            :.:|.|..:|...|.|
plant   435 AMQSYGLPKNSGDSYY 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 20/76 (26%)
PHIP1NP_191094.1 RRM1_PHIP1 163..234 CDD:409714
RRM2_PHIP1 263..334 CDD:409715 20/72 (28%)
PTZ00368 393..592 CDD:173561 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.