DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RS2Z32

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_190918.3 Gene:RS2Z32 / 824518 AraportID:AT3G53500 Length:284 Species:Arabidopsis thaliana


Alignment Length:281 Identity:105/281 - (37%)
Similarity:128/281 - (45%) Gaps:63/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRHPSDR----KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAV 61
            |.|: .||    ::|||.|.:..|..|||.:|..||.:|.|.:.|:   :|||||...|||.||.
plant     1 MPRY-DDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFSDPRDADDAR 61

  Fly    62 RGLDGRTVCGRRARVELSTG--KYARSGGGGGGGGGGG-----GGGGLGGRDRGGGGRGDDKCYE 119
            ..||||...|.|..||.|.|  :.:|..|..|...|.|     |..|...||...|. ..:|||.
plant    62 YYLDGRDFDGSRITVEASRGAPRGSRDNGSRGPPPGSGRCFNCGVDGHWARDCTAGD-WKNKCYR 125

  Fly   120 CGGRGHFARHCRE----RKARQRRRSNSFSR----SRSTSRRR---RTRSKSGTRSRSRSAGSVG 173
            ||.|||..|:|:.    :||||   ..|:||    |||..|||   |:||.|..||.|||...|.
plant   126 CGERGHIERNCKNSPSPKKARQ---GGSYSRSPVKSRSPRRRRSPSRSRSYSRGRSYSRSRSPVR 187

  Fly   174 R---------------RSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGS 223
            |               ||....|||::.|..|         ..:|:.|   :|..|.|     ||
plant   188 REKSVEDRSRSPKAMERSVSPKGRDQSLSPDR---------KVIDASP---KRGSDYD-----GS 235

  Fly   224 PRSRSRSR-SASPAVRRGSPP 243
            |:.....| ||||.|..|..|
plant   236 PKENGNGRNSASPIVGGGESP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 38/86 (44%)
RRM_SRSF3_like 9..81 CDD:240819 33/71 (46%)
RS2Z32NP_190918.3 RRM_SF 12..81 CDD:388407 33/71 (46%)
PTZ00368 <86..142 CDD:173561 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.