DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and CP33

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:80 Identity:28/80 - (35%)
Similarity:39/80 - (48%) Gaps:5/80 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SDRKVYVGDLGNNARKNDLEYVFGAYGSL--RSVWIARN---PPGFAFVEFESARDAADAVRGLD 65
            |..|||.|:||.|.....|:..||....:  ..|...||   ..||.|:.||||.:...|:..::
plant   217 SPHKVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALATMN 281

  Fly    66 GRTVCGRRARVELST 80
            |..|.||..|:.|::
plant   282 GVEVEGRALRLNLAS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 27/77 (35%)
CP33NP_190806.1 RRM_SF 117..196 CDD:473069
RRM2_NsCP33_like 220..295 CDD:410187 26/74 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.