DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RS31a

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_182184.1 Gene:RS31a / 819273 AraportID:AT2G46610 Length:250 Species:Arabidopsis thaliana


Alignment Length:276 Identity:69/276 - (25%)
Similarity:103/276 - (37%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGR 72
            |.||||:...:.|.:|||.:|..:|.::.|.:   ..|:|||.||..|||.||:|..|..|....
plant     2 RHVYVGNFDYDTRHSDLERLFSKFGRVKRVDM---KSGYAFVYFEDERDAEDAIRRTDNTTFGYG 63

  Fly    73 RARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDD--------------KCYECGGR 123
            |.::.:...|..:               |..|:.|.|....:.              :..|....
plant    64 RRKLSVEWAKDFQ---------------GERGKPRDGKAVSNQRPTKTLFVINFDPIRTRERDME 113

  Fly   124 GHFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRS------------RSAGSVGRRS 176
            .||..:.:....|.||   :|:..:..::...|::...|.:..            |.||.     
plant   114 RHFEPYGKVLNVRMRR---NFAFVQFATQEDATKALDSTHNSKLLDKVVSVEYALREAGE----- 170

  Fly   177 GRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGS 241
                 |::     ||:     ||....||.|..||....|..| |.|| ...|.:..:|..||.|
plant   171 -----RED-----RYA-----GSRRRRSPSPVYRRRPSPDYTR-RRSP-EYDRYKGPAPYERRKS 218

  Fly   242 PPRRRGDSSASRSVSR 257
            |...|..|...|:.:|
plant   219 PDYGRRSSDYGRARAR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 27/73 (37%)
RRM_SRSF3_like 9..81 CDD:240819 26/71 (37%)
RS31aNP_182184.1 RRM_SF 2..73 CDD:302621 27/73 (37%)
RRM_SF 96..165 CDD:302621 9/71 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.