DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and FPA

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001078046.1 Gene:FPA / 818942 AraportID:AT2G43410 Length:901 Species:Arabidopsis thaliana


Alignment Length:262 Identity:63/262 - (24%)
Similarity:98/262 - (37%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VYVGDLGNNARKNDLEYVFGAYGSLR--SVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGR 72
            ::||.|.....::||..:||.||.:.  :|:.:|   ||||:.:....:|..|...|.|..:.|.
plant    20 LWVGSLTPETTESDLTELFGRYGDIDRITVYSSR---GFAFIYYRHVEEAVAAKEALQGANLNGS 81

  Fly    73 RARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRERK--- 134
            :.::|     |||..........||.|..:...|.       ::.:...|:....|..||||   
plant    82 QIKIE-----YARPAKPCKSLWVGGIGPNVSKDDL-------EEEFSKFGKIEDFRFLRERKTAF 134

  Fly   135 --------ARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRY 191
                    |.|.:..|......|..|....||::  ..:.:.|||...|:|..|.:.:      |
plant   135 IDYYEMDDALQAKSMNGKPMGGSFLRVDFLRSQA--PKKEQWAGSYDNRNGNMNHKPQ------Y 191

  Fly   192 SDHERNGSGAVDSP-------PPPKRRYEDE-----------DDDRVRGSPRSRS----RSRSAS 234
            .....:..|.|...       ||...:..||           :.:||:..| ||:    ..|||.
plant   192 PHSYEDFKGDVQPSKVLWIGFPPTATQCNDEQILHNAMILFGEIERVKSYP-SRNFALVEFRSAE 255

  Fly   235 PA 236
            .|
plant   256 EA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 21/73 (29%)
RRM_SRSF3_like 9..81 CDD:240819 21/72 (29%)
FPANP_001078046.1 RRM3_Spen 20..89 CDD:240756 22/76 (29%)
RRM3_Spen 97..165 CDD:240756 15/74 (20%)
RRM3_Spen 208..280 CDD:240756 13/51 (25%)
SPOC 441..537 CDD:285043
YppG 761..>830 CDD:290883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.