DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RS2Z33

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_850280.1 Gene:RS2Z33 / 818311 AraportID:AT2G37340 Length:290 Species:Arabidopsis thaliana


Alignment Length:278 Identity:106/278 - (38%)
Similarity:135/278 - (48%) Gaps:40/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRHPSDR----KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAV 61
            |.|: .||    ::|||.|.:..|..|||.:|..||.:|.|.:.|:   :|||||...|||.||.
plant     1 MPRY-DDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFGDPRDADDAR 61

  Fly    62 RGLDGRTVCGRRARVELSTG--KYARSGGGGGGGGGGG-----GGGGLGGRDRGGGGRGDDKCYE 119
            ..||||...|.|..||.|.|  :.:|.....|...|.|     |..|...||...|. ..:|||.
plant    62 HYLDGRDFDGSRITVEFSRGAPRGSRDFDSRGPPPGAGRCFNCGVDGHWARDCTAGD-WKNKCYR 125

  Fly   120 CGGRGHFARHCRERKARQRRRSNSFSRS--RSTSRRRR---TRSKSGTRSRSRSAGSVGRRS--- 176
            ||.|||..|:|: ...::.|||.|:|||  ||.|.|||   :||.|.:||.|||...|.||.   
plant   126 CGERGHIERNCK-NSPKKLRRSGSYSRSPVRSRSPRRRRSPSRSLSRSRSYSRSRSPVRRRERSV 189

  Fly   177 ---GRSNGRDENGSASRYSDH----ERNGSGAV--DSPPPPKRRYEDEDDDRVRGSPRSRSRSRS 232
               .||..|.::..:.|..|.    :..||..:  .||||..:..::...||..|||:...|:..
plant   190 EERSRSPKRMDDSLSPRARDRSPVLDDEGSPKIIDGSPPPSPKLQKEVGSDRDGGSPQDNGRNSV 254

  Fly   233 ASPAVRRGSPPRRRGDSS 250
            .||.|..|      ||||
plant   255 VSPVVGAG------GDSS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 38/86 (44%)
RRM_SRSF3_like 9..81 CDD:240819 33/71 (46%)
RS2Z33NP_850280.1 RRM_SF 12..81 CDD:418427 33/71 (46%)
PTZ00368 <86..144 CDD:173561 19/59 (32%)
MSCRAMM_ClfB <209..>289 CDD:411414 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.