DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and AT2G27330

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_565646.2 Gene:AT2G27330 / 817276 AraportID:AT2G27330 Length:116 Species:Arabidopsis thaliana


Alignment Length:81 Identity:24/81 - (29%)
Similarity:39/81 - (48%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAADAVRGLDGRTV 69
            ::|..:..::.:..|...|..||.:..|.:..:     |.|||:|.|.|..:|..|:..|:.:.|
plant    23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLV 87

  Fly    70 CGRRARVELSTGKYAR 85
            .||  .|.|.|.|.|:
plant    88 DGR--VVILDTTKAAK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 21/75 (28%)
AT2G27330NP_565646.2 RRM_SF 23..99 CDD:473069 22/77 (29%)

Return to query results.
Submit another query.