DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RSZ22a

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_180035.1 Gene:RSZ22a / 816995 AraportID:AT2G24590 Length:196 Species:Arabidopsis thaliana


Alignment Length:250 Identity:104/250 - (41%)
Similarity:125/250 - (50%) Gaps:60/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :||||:|.....:.:||..|.::|.:||||:||.|||:||::||.:|||.||:|.:||:    ..
plant     3 RVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFEDSRDARDAIREVDGK----NG 63

  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRERKARQR 138
            .|||.|..:      |||||.|||.|||.|||.|||   .|.||||||..|||||.||.|.....
plant    64 WRVEQSHNR------GGGGGRGGGRGGGDGGRGRGG---SDLKCYECGESGHFARECRSRGGSGG 119

  Fly   139 RRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVD 203
            || .|.|||||..|.|::.:..|.||                          ||...|       
plant   120 RR-RSRSRSRSPPRYRKSPTYGGRRS--------------------------YSPRAR------- 150

  Fly   204 SPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRRG----DSSASRS 254
            |||||:||         ..|||.|:.|||..|...|...|...|    |...|||
plant   151 SPPPPRRR---------SPSPRGRNYSRSPPPYRARDEVPYANGNGLKDVRRSRS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 34/72 (47%)
RRM_SRSF3_like 9..81 CDD:240819 34/71 (48%)
RSZ22aNP_180035.1 RRM_SRSF3_like 3..71 CDD:240819 34/71 (48%)
zf-CCHC 97..111 CDD:278525 11/13 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3142
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I1677
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - mtm954
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.