DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and AT2G21440

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_565513.1 Gene:AT2G21440 / 816683 AraportID:AT2G21440 Length:1003 Species:Arabidopsis thaliana


Alignment Length:215 Identity:46/215 - (21%)
Similarity:73/215 - (33%) Gaps:89/215 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAADAVRGLDGRT 68
            |:.:.:|...|:.:|::.||.|.|.:..|:|.:|     |.|||||:|...:|||:|::..:|..
plant   332 KLIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKFTCKKDAANAIKKFNGHM 396

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRER 133
            ...|...|:.:..|...:|.                                             
plant   397 FGKRPIAVDWAVPKNIYNGA--------------------------------------------- 416

  Fly   134 KARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNG 198
                                          :.:.:|.:.|.:.| |:|..||.|.......|   
plant   417 ------------------------------ADATTASADGDKEG-SDGDSENSSVDLEEVDE--- 447

  Fly   199 SGAVDSPPPPKRRYEDEDDD 218
              ||:|.|||.   :|.|||
plant   448 --AVESHPPPG---DDTDDD 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 25/76 (33%)
AT2G21440NP_565513.1 RRM1_RBM28_like 21..99 CDD:409847
ELAV_HUD_SF 24..411 CDD:273741 25/78 (32%)
RRM2_RBM28_like 332..408 CDD:409848 25/75 (33%)
RRM3_RBM28_like 561..642 CDD:409849
RRM4_RBM28_like 713..810 CDD:409850
PTZ00121 <813..>968 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.