DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SRSF4

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_005617.2 Gene:SRSF4 / 6429 HGNCID:10786 Length:494 Species:Homo sapiens


Alignment Length:379 Identity:105/379 - (27%)
Similarity:136/379 - (35%) Gaps:140/379 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :||:|.|...||:.|:|..|..||.:..|.:..   |:.||||:..|||.|||..|:|:.:||.|
Human     3 RVYIGRLSYQARERDVERFFKGYGKILEVDLKN---GYGFVEFDDLRDADDAVYELNGKDLCGER 64

  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGL--GGRDRGG--------------------------- 109
            ..||     :||.....|..|.|..|.|.  .|||:.|                           
Human    65 VIVE-----HARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYM 124

  Fly   110 ------------GGRGDDKCYE---------------------------------------CGGR 123
                        .||.::...|                                       ...|
Human   125 RQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSRRRRSYSRSR 189

  Fly   124 GHF-----ARHCRERKAR----------QRRRSNSFSRSRSTSRRR------------RTRSKSG 161
            .|.     :||.|:.::|          .|.||.|.|||||.||.|            |:.||..
Human   190 SHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKEK 254

  Fly   162 TRSRSRSAG------------------SVGRRSGRSNGRDENGSASRYSDHER----NGSGAVD- 203
            :||||.|||                  :||:...||..|.::.|.||....||    ...|:|. 
Human   255 SRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKSRSRSQERRVEEEKRGSVSR 319

  Fly   204 SPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRRGDSSASRSVSR 257
            .....|...:.....|.:|..||||||||.|...|:|.  :|..:.|.|||.||
Human   320 GRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGR--KRSREESRSRSRSR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 30/72 (42%)
RRM_SRSF3_like 9..81 CDD:240819 30/71 (42%)
SRSF4NP_005617.2 RRM1_SRSF4_like 3..72 CDD:240783 31/76 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..95 7/22 (32%)
RRM2_SRSF4_like 104..175 CDD:241044 3/70 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..494 61/205 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.